RetrogeneDB ID:
retro_csav_1
Organism:
Ciona savignyi ( Ciona_savignyi )
Location:
reftig_30:3357785-3359282 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
51.15 %
Coverage:
95.98 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CSA.8408
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_csav_1
ACAATAAGGTCATTTTTCTATTATACATTTATAAACAAAGAAATGTCAGAAAATGATGAA
CCAAGCACTTCATTTCAAGATGTTACAAAAACTCAGCAATCAGTTAACCTGAAGCAGAAG
ATAACACTGGCAAATGGCGTGGCACTTATTGTTGGAAACATCATTGGCTCTGGTATTTTT
CTAAGTCCAAAAGGAGTCCAGGAAAAATGCGGCTCACCTGGTTTAAGTTTAATAATCTGG
TCAATATGTGGAGTCTTTTCTCTAATCGGTGCTTTGTGCTATGCTGAACTTGGTACAACT
ATTATTAAATCCGGTGCCAGTTATGCCTACATTTTACGAGCCTTTGGCCCTTTAGTAGGT
TTTGTTCGACTGTGGATATCTGTTCTTATTATTGAGCCTACAGTCCAAGCAGCTATTGCT
ATAACGTTTGCGAATTATTTAATTCAACCGTTTTTCCCCACATGTGAACCACCATTTTAT
GCTGTACGTTTGTTAGCAGCTGCTTGTGTTATCATAATCATGGTAATGAATTGCTTCAGT
GTACGGTATGGAACAAGAATACAAGACATCTTTGCTTATGCCAAAGTCCTTGCCCTGATT
GTCATTATGATTGTTGGGTTTATTGCACTTGGCAATGGAACATCTTCCAGTTCATTGGCT
GAACCTTGGAAAGGAACAACTAATAATATTGGAAACATAGCCCTTGCGTTATACTCTGGC
CTGTATGCCTATTCGGGATGGGATACACTGAACTTCATGGTGGAAGAGTTGCAGGATCCA
TATCGCAATCTACCGAAGGCAATTTATATTTCACTTCCACTCTGTACTATCATTTACATT
CTAACAAACATTGCTTACTATGCTATTTTGACACCGGCTGAATTGATAGCAACGGATGCT
GTTGCTGTCAGCTTTGCTGGTAAAACATTAGGAGTCATGCAGTGGACCATACCCATTGCT
GTAGCAATGTCAACTTTTGGTGGACTGAATTCATCTATCATGGCCTCTTCCCGTTTGTTT
TTCGTCGGTGCACGTGAAGGTCATTTACCGGACTACCTTGCCATGGTTAATTTTAAAAGA
TTCACCCCTGCTCCAAGTTTGCTTTTCACCGGGACACTTACTCTTGTATTCCTATGTGTA
AGTGATGTTTTTGACCTGATTAACTACTACAGCTTCATGTATTGGCTAGCAGTTGGTTTA
TCAATTGCTGGGCAAATCTACCTTAGATTTACCGAACCCAAACTGCCCAGACCTCTAAAA
GTTAATATTATTTTCCCCATAATATTTTGTCTTGCCTGCTTGTTTTTGGTTATTGTGCCA
TTCTTTGAAGAAACACGGGATTCACTAATCGGTACTGCCATTCTTGCAACTGGTATACCA
ATCTACTTTTTCTTCGTTTACTTGAAACAGCCAGCATTCCTCTCAAAGATTAGCAACGCA
GTAACCGGATTTCTACAAAAGTTGCTTCCTGTTTCTATCTCAGATATGGAAATTGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DGEESSSSDSSEGVGESKIILKQRITLVNACALIVGTIIGSGIFISPVGVFREVNSVGLSLIVWTIGGFFSTIGALCYAELGTTIVKSGGDYAYIREFYG
...E.S.S............LKQ.ITL.N..ALIVG.IIGSGIF.SP.GV.....S.GLSLI.W.I.G.FS.IGALCYAELGTTI.KSG..YAYI....G
Retrocopy
ENDEPSTSFQDVTKTQQSVNLKQKITLANGVALIVGNIIGSGIFLSPKGVQEKCGSPGLSLIIWSICGVFSLIGALCYAELGTTIIKSGASYAYILRAFG


Parental protein
PLPAFLRLWIALLIIRPTSQAAIALTFSSYLVQPFFPNCTELMPESSIRLFAALSLIILSLVNCMSVRWATRVQDVFTAAKLLALAIIIIIGVVKIGQAT
PL..F.RLWI..LII.PT.QAAIA.TF..YL.QPFFP.C....P....RL.AA...II....NC.SVR..TR.QD.F..AK.LAL..I.I.G....G..T
Retrocopy
PLVGFVRLWISVLIIEPTVQAAIAITFANYLIQPFFPTCEP--PFYAVRLLAAACVIIIMVMNCFSVRYGTRIQDIFAYAKVLALIVIMIVGFIALGNGT


Parental protein
HTHTHTS-FKGTTSDIGRIVIAFYNSLYAYGGWNYLNFVTEEMKDPYKNLPRAIMISLPLVSFIYVTANIAYFTVLSPTEFGISNAVAVLFGDKVLGVMS
.........KGTT..IG.I..A.Y..LYAY.GW..LNF..EE..DPY.NLP.AI.ISLPL...IY...NIAY...L.P.E.....AVAV.F..K.LGVM.
Retrocopy
SSSSLAEPWKGTTNNIGNIALALYSGLYAYSGWDTLNFMVEELQDPYRNLPKAIYISLPLCTIIYILTNIAYYAILTPAELIATDAVAVSFAGKTLGVMQ


Parental protein
WIIPVFVSLSCFGSVNGSIFTSSRLFFVGAREGQLPNILAMIHTKHFTPVPAIMFNCILSLLYLVSGDIWSLITYFSFFNWLCVGMAILGLLHWRYKYPD
W.IP..V..S.FG..N.SI..SSRLFFVGAREG.LP..LAM...K.FTP.P...F...L.L..L...D...LI.Y.SF..WL.VG..I.G....R...P.
Retrocopy
WTIPIAVAMSTFGGLNSSIMASSRLFFVGAREGHLPDYLAMVNFKRFTPAPSLLFTGTLTLVFLCVSDVFDLINYYSFMYWLAVGLSIAGQIYLRFTEPK


Parental protein
MERPVKMHISLPITFFIAAAFLVVMAVYAAPKECLIGACIVLTGIPVYLIGVRYQHKQPKWLDNGMDSVTIFCQTFLGV
..RP.K..I..PI.F..A..FLV...........LIG..I..TGIP.Y...V....KQP..L......VT.F.Q..L.V
Retrocopy
LPRPLKVNIIFPIIFCLACLFLVIVPFFEETRDSLIGTAILATGIPIYFFFVYL--KQPAFLSKISNAVTGFLQKLLPV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide