RetrogeneDB ID:
retro_csav_11
Organism:
Ciona savignyi ( Ciona_savignyi )
Location:
reftig_551:260490-260817 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.29 %
Coverage:
97.22 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CSA.3865
Parental gene aliases:
No gene alias available
Parental gene description:
Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:H2Z293]

Genomic region (view in browser)





>retro_csav_11
ATGGGTGTGGAAATTGAGACGATAAAGCCTGGAGATGGTGTGAATTTCCCCAACCGTGGA
CAGACCGTCGCAGTTCATTACACTGGTACCTTGGAGAACGGAACGAAGTTTGACTCTTCA
TATGATCGTGGGAAGCCATTTACATTTCGGATCGGGTTGGGCCAAGTTATAAGGGGTTGG
GACGAAGGAGTAGCTCAAATGTCGATCGGACAAAAAGCCAAGTTGACATGTAGTCCAGAT
TATGCATACGGTAGTCGCGGCCATCCAGGAGTAATTCCACCAAACGCTACTCTTATCTTC
GTAGTTGAACTACTCGGTATAGATTAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGVTVETITAGDGTNFPKSGQTVCVHYTGTLTNGKKFDSSRDRGKAFEFVIGKAQVIRGWDEGVMQMSVGQRATLTCTPDYAYGANGIGGVIPPNATLVF
MGV..ETI..GDG.NFP..GQTV.VHYTGTL.NG.KFDSS.DRGK.F.F.IG..QVIRGWDEGV.QMS.GQ.A.LTC.PDYAYG..G..GVIPPNATL.F
Retrocopy
MGVEIETIKPGDGVNFPNRGQTVAVHYTGTLENGTKFDSSYDRGKPFTFRIGLGQVIRGWDEGVAQMSIGQKAKLTCSPDYAYGSRGHPGVIPPNATLIF


Parental protein
DVELL
.VELL
Retrocopy
VVELL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide