RetrogeneDB ID:
retro_csav_25
Organism:
Ciona savignyi ( Ciona_savignyi )
Location:
reftig_431:115299-115575 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.65 %
Coverage:
85.98 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CSA.1484
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_csav_25
ATGAATAAAGACAAATTAACCAAGTTGCAAAATGAAGTAACGATGAGAGGAAAGGGATCA
CCTCGAAGAAAGCGTAAATTTGTTCGTCGAAGAGCCACGATCGATGAAAAGAAATTGCAA
AGTTTGTTGGAAAAAATAGCTGTGAAAACTATCCCCGGGTTCGATGAAGTGGATATGATT
AAGGACGACGGCAACGTAATTCACTTTAACAAACCGAACGTTCAGATTTCTTTGTCAGCG
AATACAACCGTGGTGACCGGTCACGCTGAGAACCAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MNKDKLNKLQDQVRIGGKGSARRKRKVVHRTATTDDKKLQSSLKKLAVNNIPGIEEVNMIKDDGNVIHFNNPKVQASPSANTFAVTGHAENK
MNKDKL.KLQ..V...GKGS.RRKRK.V.R.AT.D.KKLQS.L.K.AV..IPG..EV.MIKDDGNVIHFN.P.VQ.S.SANT..VTGHAEN.
Retrocopy
MNKDKLTKLQNEVTMRGKGSPRRKRKFVRRRATIDEKKLQSLLEKIAVKTIPGFDEVDMIKDDGNVIHFNKPNVQISLSANTTVVTGHAENQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide