RetrogeneDB ID:
retro_csav_27
Organism:
Ciona savignyi ( Ciona_savignyi )
Location:
reftig_51:514272-515175 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.26 %
Coverage:
96.49 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CSA.10368
Parental gene aliases:
No gene alias available
Parental gene description:
Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:H2YP82]

Genomic region (view in browser)





>retro_csav_27
GATTTGGACAAAATGCTTGAAATTGCTAAACAGTGTAAATATCTTCCGGAATATGATTTA
AAGAAATTGTGCGATTATGTATGTGATCTACTGCTAGAGGAGTCAAATGTCCAACCTGTA
TCAACACCAGTTACAGTTTGCGGAGACATCCATGGTCAATTTTACGACCTACAAGAGCTT
TTCAAGACTGGAGGGGAAGTGCCTGACACAAACTACATTTTCATGGGCGATTTTGTGGAT
AGAGGATATTACAGTTTGGAAACATTGACATGTCTGCTAACATTAAAGGCTAAATGGCCA
AACAAGATCACATTATTGAGAGGAAATCACGAAAGTCGTCAAATCACACAGGTGTATGGG
TTTTATGATGAGTGCCAGACAAAGTATGGAAATGCCAATGCATGGAGATACTGTACTAAG
GTGTTCGACTTGCTAACAATTGCGGCAATAATAGATTCCACGATACTCTGTGTTCATGGT
GGCCTTTCGCCGGATGTAAAAACCCTGGATCAAATTCGCACCATAGACCGCCAGCAAGAG
ATCCCACATAAAGGAGCGTTTTGCGACCTCGTGTGGTCGGATCCAGAGGATGTAGACACA
TGGGCGATATCCCCTCGAGGGGCTGGTTGGTTATTTGGAGCTAAAGTAACCAACGAGTTT
GTCCATCTCAACAATCTTTCTCTTATCTGTCGGGCACATCAACTCGTACACGAAGGCTTC
AAGTACATGTTTGGTGAGAAACTGGTTACTGTATGGTCGGCTCCTAACTATTGCTACAGA
TGTGGAAATATTGCTGCAATTCTTGTGGTGCATACCAAAGAAGACAGAGAAGCAAAACTT
TTTCGTGCAGTTCCTGATAATTTGAGAGTTATTCCAGAGCGCAATACAACGCCGTACTTC
CTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DLDRQIEQLKRCEIIKESEVKALCAKAREILVEESNVQRVDSPVIVCGDIHGQFYDLTELFKVGGDMPDTNYLFLGDFVDRGFYSVETFLLLLALKVRYP
DLD...E..K.C....E...K.LC......L.EESNVQ.V..PV.VCGDIHGQFYDL.ELFK.GG..PDTNY.F.GDFVDRG.YS.ET...LL.LK...P
Retrocopy
DLDKMLEIAKQCKYLPEYDLKKLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLQELFKTGGEVPDTNYIFMGDFVDRGYYSLETLTCLLTLKAKWP


Parental protein
DRIVLIRGNHESRQITQVYGFYDECLRKYGSITVWRYCTEIFDYLSLSAIIDGRIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTTG
..I.L.RGNHESRQITQVYGFYDEC..KYG....WRYCT..FD.L...AIID..I.CVHGGLSP...TLDQIRTIDR.QE.PH.G..CDL.WSDPED...
Retrocopy
NKITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDLLTIAAIIDSTILCVHGGLSPDVKTLDQIRTIDRQQEIPHKGAFCDLVWSDPEDVDT


Parental protein
WGVSPRGAGYLFGSDVVSNFNHQNDIDMICRAHQLVMEGFKWHFNETVLTVWSAPNYCYRCGNVAAIFALDEHLKREFIIFEAAPQETRGLPVKKPLPDY
W..SPRGAG.LFG..V...F.H.N....ICRAHQLV.EGFK..F.E...TVWSAPNYCYRCGN.AAI........RE...F.A.P...R..P.....P.Y
Retrocopy
WAISPRGAGWLFGAKVTNEFVHLNNLSLICRAHQLVHEGFKYMFGEKLVTVWSAPNYCYRCGNIAAILVVHTKEDREAKLFRAVPDNLRVIPERNTTP-Y


Parental protein
FL
FL
Retrocopy
FL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide