RetrogeneDB ID:
retro_csav_28
Organism:
Ciona savignyi ( Ciona_savignyi )
Location:
reftig_51:1083566-1084191 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.5 %
Coverage:
95.83 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_csav_28
TTAACCAGGATGGAAATCACCAGCAACAGTGTTCTCATGGTTTTAGCTGGTTATGAGACT
TCTGCAAACTTAATGTGCTTTCTAGCTTATAACCTTGCTGTCTATAAAGAAGCCCAGAGA
ATGGTACAAGAGGAAATTTCCCACACTCTAGAGGAGTATGGATCATTTACATACGAAGCA
TTAAACAGCATGAAGTATTTGACTTCGTGTATACAAGAAACCTTGAGGCTGTACCCACCA
ATAGCTATTAATTCTCGCTTTCCCATAAAAGACATAACCATCAACGGCATATTCTTTCAA
AAGGGAATACAAGTCAACATACCTGTCTATGGACTAAGCCGAGATGATGAAATATGGGAT
GAACCATTGAATTTCAAACCGGAACGGATGTCAGATATGTCCAAGATCAACTCCATGGTA
TTTCAGCCCTTTGGTGGTGGGCCTCGGTGGTTGTATCGGCATGCGATTCGCGCTTCTGGA
AATTAAGCTCGTCTTCTGCAAATTTCTACAGCAGTTTAACATTGATGTGTGTGAGGATAC
TCCAGAGCCGCCCTTAGCTATGTTGTTTAGATCTACAACACTTAAGCCAAAGGAGAATAT
TTTTTTGAAATTATCGAGGAGGGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MTRVEIKGNSLIFIFGGYETTSNAMLFLAYNLALHKDAQHHVREEVQAALHKHGGLTYEAIQDLKYMTQCLNESLRLYPLTPMNSRYCEQDITINGITIP
.TR.EI..NS......GYET..N.M.FLAYNLA..K.AQ..V.EE....L...G..TYEA....KY.T.C..E.LRLYP....NSR....DITINGI...
Retrocopy
LTRMEITSNSVLMVLAGYETSANLMCFLAYNLAVYKEAQRMVQEEISHTLEEYGSFTYEALNSMKYLTSCIQETLRLYPPIAINSRFPIKDITINGIFFQ


Parental protein
RGATVGIPMFGMMRDEDIWEDPLIFNPDRMEDMSKIDPMIYQPFGAGPR-NCIGMRFALLEIKITFAKLLLKFDLDVCEDTPEPPLAVTFK-TSMRPKET
.G..V.IP..G..RD..IW..PL.F.P.RM.DMSKI..M..QPFG.GPR..CIGMRFALLEIK..F.K.L..F..DVCEDTPEPPLA..F..T...PKE.
Retrocopy
KGIQVNIPVYGLSRDDEIWDEPLNFKPERMSDMSKINSMVFQPFGGGPR\GCIGMRFALLEIKLVFCKFLQQFNIDVCEDTPEPPLAMLFRSTTLKPKEN


Parental protein
LYLKVVGRE
..LK...RE
Retrocopy
IFLKLSRRE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide