RetrogeneDB ID:
retro_csav_29
Organism:
Ciona savignyi ( Ciona_savignyi )
Location:
reftig_54:2592428-2592820 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
93.18 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
CSA.4860
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_csav_29
ATGTCATCAACTTTTGCTCGAGCTGTCGCGGCAGTGGCTGCGAAGCGAGTTCCTATAAAA
CCGATCGTTTCTGCCAATCCGTACCAAGCTAAACGAAGAGTTTTGACGTTATACAAGCAA
TGGTACCGCGCAGTGCCGCTGATAATTAGAACGTACCAACTACCATATGCAGTTGAAACT
GTCCAAGAAAAAATTAAGGAGCAATTGATGAAGAATTCCCATGTTTCGAGATGTAAGAGC
AATCGATATTTTGATCATCAAGGGAGAGATGGATCTGCAAGAGACATTACTAAACTGGAA
GCAAAATTGCCATGTGCGTGATTATTTTAGAAAACCCAACCGAAGTCCAAGAACCCACTA
ATTTTCTTGGAAAATTTTGGACTCAAAAACAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSSTFARAVAAGAAKRVPIKPIVSANPDQAKRRVLTLYKQWYRAVPLIIRTYQLPYAVETVQEKIKEQFMKNSHV-RDVRAIDILIIKGEMDLQETLLNW
MSSTFARAVAA.AAKRVPIKPIVSANP.QAKRRVLTLYKQWYRAVPLIIRTYQLPYAVETVQEKIKEQ.MKNSHV.RDVRAIDILIIKGEMDLQETLLNW
Retrocopy
MSSTFARAVAAVAAKRVPIKPIVSANPYQAKRRVLTLYKQWYRAVPLIIRTYQLPYAVETVQEKIKEQLMKNSHV\RDVRAIDILIIKGEMDLQETLLNW


Parental protein
KQDCHVRDYF-ENPTKVQEPTDFLGKFLTQKH
KQ.CHVRDYF.ENPT.VQEPT.FLGKF.TQKH
Retrocopy
KQNCHVRDYF\ENPTEVQEPTNFLGKFWTQKH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide