RetrogeneDB ID:
retro_csav_31
Organism:
Ciona savignyi ( Ciona_savignyi )
Location:
reftig_55:1114347-1115506 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.16 %
Coverage:
57.25 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_csav_31
AAATGTGAAGTATGTGGAAAATGTTTTCAAAATCGTGATGTTTTGATGGTTCATTTGAGA
ACTCATACTGGAGAACGACCTTACACATGTGATATATGCAAGAAATCCTTCAAGCAAAAG
ATACACTTAGATACCCACACAAAATGTCATTTTAATAATCCAGATTTTAAGTGTAGGCTC
TGTGAAAAATCGTACAATATAAAATCCGATCTAAATATACATATGAAGACTCATGCTGGA
GAGAGAGCGTATTCGTGTGATGTGTGTGACAAAACATTTGTTCATGCCGCCGGATTGAAT
CTCCACAAGAAACTTCACACTACTGAAAGGCCATACAAATGCAGTTTGTGCGAAAAATCT
TTTACAAGAAGTCATCATTTGCAAATACATCACTTGAGTCACACTGGTCAGATGCCTTAT
AAATGTGATGTGTGTGAGAAAACCTTCCGACAAAGTAGCAATATGAGGTCGCACAAAGCA
ACTCACAACAAAGAAAAAACAAAAAAATGTGACATTTGTGGAAATATGTTTGCTACACAA
AAAAATTTAAATATTCATCGAAAAATTCATTCTGAACGGAGTAAAGTCAAATGCAATGTA
TGTGAAAAGTCATACAGCTCTGCTGCAGCCTTGAAAATACACCAACGTTCACACAGTGGT
GAGAGACCGTACAAATGTGAAGTTTGTCATCGAAGCTTTCGTGACGGTTCAGATCTCAAA
AAACATAAAACAATTCATACTGGAGAGAAACCTCACAAATGTGATGTATGTGAGAAATCA
TTCAGATCGGCCTTTGATCTAAAAGCACATCAACTGATCCACGGTGAAGAGAGGCTGTAC
AAATGTGATGTCTGTGAAAAGTCGTTCCGTCAGAAACCTGGTTTAAATTCGCACCGTAAA
ATTCATGATGGTGTGAAACCATTCAAGTGTAAAACATGTTAAAAATTATTTCGTACAAGT
TCAGAGATGAAGAAACACGAAAGGATTCACACCAACGAGAAACCGTTTACATGCACCATT
TGCGAACGCAGCTTTCTCCACTCTAATTCCCTAAAACAACATGAACGAATTCACACCGGG
AGAGAAACCTTACAAATGTAACATTTGCGAGAGAATGTTTAATTGTCAAAGCAACATGAG
AAAACATCAAGCAAGGCAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KCSFCEKSFTRSHHLKIHHMTHTGQMPYKCDVCEKTFRQSSNMRTHKATHNKEKTIKCDVCGNMFATQMHLNKHQKIHSERKRPFSCDVCEKTFVYATGL
KC..C.K.F.....L..H..THTG..PY.CD.C.K.F.Q.....TH...H......KC..C.........LN.H.K.H....R..SCDVC.KTFV.A.GL
Retrocopy
KCEVCGKCFQNRDVLMVHLRTHTGERPYTCDICKKSFKQKIHLDTHTKCHFNNPDFKCRLCEKSYNIKSDLNIHMKTHAG-ERAYSCDVCDKTFVHAAGL


Parental protein
NLHKKLHTAERPYKCSFCEKSFTRSHHLKIHHMTHTGQMPYKCDVCEKTFRQSSNMRTHKATHNKEKTIKCDVCENMFATQMHLNKHRKIHSERSKFKCN
NLHKKLHT.ERPYKCS.CEKSFTRSHHL.IHH..HTGQMPYKCDVCEKTFRQSSNMR.HKATHNK.....CD.C.NMFATQ..LN.HRKIHSERSK.KCN
Retrocopy
NLHKKLHTTERPYKCSLCEKSFTRSHHLQIHHLSHTGQMPYKCDVCEKTFRQSSNMRSHKATHNKXXXXXCDICGNMFATQKNLNIHRKIHSERSKVKCN


Parental protein
VCEKSYNSALALKIHQRSHSDERPYKCEVCDRSFRDGSVLKKHKTIHTGEKPHKCDVCEKSFRSAGYLKAHQLIHGEDRLYKCDVCEKSFRQRPGLNSHR
VCEKSY.SA.ALKIHQRSHS.ERPYKCEVC.RSFRDGS.LKKHKTIHTGEKPHKCDVCEKSFRSA..LKAHQLIHGE.RLYKCDVCEKSFRQ.PGLNSHR
Retrocopy
VCEKSYSSAAALKIHQRSHSGERPYKCEVCHRSFRDGSDLKKHKTIHTGEKPHKCDVCEKSFRSAFDLKAHQLIHGEERLYKCDVCEKSFRQKPGLNSHR


Parental protein
KIHEGEKPFKCETCGKLFGTSSQMKKHEKIHTDEKPFTCTICERSFLLSKCLKQHERIHT-GEKPYKCDICQRMFSLKCKLNIHMKTH
KIH.G.KPFKC.TC.KLF.TSS.MKKHE.IHT.EKPFTCTICERSFL.S..LKQHERIHT.GEKPYKC.IC.RMF........H...H
Retrocopy
KIHDGVKPFKCKTC*KLFRTSSEMKKHERIHTNEKPFTCTICERSFLHSNSLKQHERIHT\GEKPYKCNICERMFNCQSNMRKHQARH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide