RetrogeneDB ID:
retro_csav_7
Organism:
Ciona savignyi ( Ciona_savignyi )
Location:
reftig_726:33665-34748 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
76.92 %
Coverage:
55.18 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_csav_7
TACAACTTGGGAAGTCGTGGAAATGAGTTATCGACTCGAAAGATCATTTTCGCCAACTTC
AACCAGGATTGCACCTCGCTGGCTGTGGGGACCAAACATGGATACAAACTATTCGCGCTG
AACTCCGTGGATACGTTGGATGTGATTTACGACAATGAGAGCGAAACAGAAGACGTTTGT
TTGGTCGATCGCTTGTTCTCAAGCAGCCTGGTTGCGATCGTGAGTCTCATGTCCCCGCGG
AAGCTGAAGGTCTGCCATTTCAAGAAAGGAACCGAGATCTGCAATTACAGCTACTCGAAC
ACGATACTCGGGGTGAAACTGAATCGAATCCGACTTGTGGTGGTCCTCGAAGAGAGCTTG
TACATTCACAACATCAGAGACATGAAAGTGTTGCACACCATACGCGATACACCCAGCAAT
CCTAAAGGTCTCTGCTGCCTCAGTGTCAACAATGATAATTCCTTCCTTGTCTACCCAGGT
AGTAGCATAACAGGGGAAGTACAAATATTCGACGTCACCACCCTCAATGCAGTAAGCACC
ATCAACGCACACGATAGTCCTCTCGCTGCTATGGCGTTCAATTCCACAGCAACTAAACTG
GCAACAGCCTCCTGCAAAGGAACTGTGATCAGAGTGTTCTCGGTGCCTGATGGACAAAAA
CTCTTTGAGTTCCGACGAGGGGTGAAGCGATGCGTTTCCATCGGATCCCTTGCGTTCAGC
CCCGATTCCCTCTTCCTCTGCGCCTCCAGCAACACCGAAACCGTCCACATTTTCAAACTG
GAGCAAATGGGAGCTGAGAAAGCTCCAGTGGCGGACGAATCGTCATCCTGGATGGGATAT
TTCAACAAAGTATTGAGCAATTCTGCCAGTTACCTTCCAAGTCAGGTTTCCGAGGTTTTG
AACCAAGGACGTGACTTCGCGACGGTGAAACTCTCGTTCCAGGGGTCGAGGAATGTTTGT
GCGATCACCACCCTGCAGAAGCTCCCTCGTGTGCTGGTGGCTGACGAGGACGGCTTCTTG
TACATCTACAACCTCGACCCGATGGATGGTGGGGAGTGCGCGTTGCTTCGACAGCACAAC
CTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LLFANFNQDFTSLAVGGRYGYRILALNSVDNLEEIHSEE--ISDVCLVERLFSSSLVAHVSLASPRKLKVCHFKKKTEICNYSYSNTILAVKLNRIRLVV
..FANFNQD.TSLAVG...GY...ALNSVD.L..I...E....DVCLV.RLFSSSLVA.VSL.SPRKLKVCHFKK.TEICNYSYSNTIL.VKLNRIRLVV
Retrocopy
IIFANFNQDCTSLAVGTKHGYKLFALNSVDTLDVIYDNESETEDVCLVDRLFSSSLVAIVSLMSPRKLKVCHFKKGTEICNYSYSNTILGVKLNRIRLVV


Parental protein
LVEESLYIHNIHDMKVLHTIRDTPSNPLGICALSGNNDNALLAYPGSPHTGEVQIFDVANLKAVTMIHAHNNPLAALAFNRLATQLATASDKGTVIRVFS
..EESLYIHNI.DMKVLHTIRDTPSNP.G.C.LS.NNDN..L.YPGS..TGEVQIFDV..L.AV..I.AH..PLAA.AFN..AT.LATAS.KGTVIRVFS
Retrocopy
VLEESLYIHNIRDMKVLHTIRDTPSNPKGLCCLSVNNDNSFLVYPGSSITGEVQIFDVTTLNAVSTINAHDSPLAAMAFNSTATKLATASCKGTVIRVFS


Parental protein
VVNGNKLFEFRRGMKRCVSICSLAFSADSLFLAASSNTETVHLFKLE
V..G.KLFEFRRG.KRCVSI.SLAFS.DSLFL.ASSNTETVH.FKLE
Retrocopy
VPDGQKLFEFRRGVKRCVSIGSLAFSPDSLFLCASSNTETVHIFKLE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide