RetrogeneDB ID:
retro_dmel_17
Organism:
Drosophila melanogaster ( Drosophila_melanogaster )
Location:
3L:15465721-15466678 (-)
Status:
KNOWN_PROTEIN_CODING
Ensembl ID:
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.4 %
Coverage:
58.38 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TBPH
Parental gene aliases:
No gene alias available
Parental gene description:
TAR DNA-binding protein-43 homolog [Source:FlyBase gene name;Acc:FBgn0025790]

Genomic region (view in browser)





>retro_dmel_17
ATGGTTTTCGTTCACGTTTCGGAGAAGGAGGGCGACGAGCCCATCGAGCTGCCGGCTGAG
GAGGATGGCACTTTGCTGCTGTCCACACTGCAGGCGCAGTTTCCGGAATCTAGCGGTCTG
CAGTACCGCAACGTGGACACGAAGGCGGTGCGTGGAGTTCGCTCCAACGAGGGCCGACTG
TATTCGCCCAGCGAAGAAACCGGCTGGGGCGAGTACCATTACTTTTGCGTCTTTCCCAAG
AAGAACAAGCGCCAGAGCGAAGATAACTTGGAAAACTCAACTGCCAAAACCAAGCGCACT
GAGGCCCATCTGCGCTGCTTTGATCTCATCGTGCTCGGCTTGTCCTATAACACCACCGAG
CAGGATTTGCGTGAGTACTTCGAGACCTACGGCGATGTGGTGAAGGCTGAGATCAAGAAG
GACACCAGGTCGGGCCACTCCAAGGGTTTCGGGTTCGTGCGCTTCGGCTCTTACGATGTC
CAGATGCACGTACTCTCTAAGCGCCATTCAATTGATGGTCGCTGGTGCGAGGTTAAGGTG
CCCGCCTCGAGGGGCATGGGCAATCAGGAGCCTGGCAAGGTATTCGTCGGCCGCTGCACC
GAGGACATAGAGGCGGATGACTTGCGCGAGTACTTCTCAAAGTTTGGCGAAGTGATCGAC
GTGTTCATTCCCAAGCCCTTCAGGGCTTTTAGCTTTGTAACCTTTCTCGATCCGTATGTA
CCACGCGTCGTGTGCGGAGAGAAACACATAATCAAGGGAGTTTCGGTCCATGTGTCGACT
GCTGACAAAAAGAACGTGCAGAACAAAAACCAACTGTTCCAGACCAACAACTACAACAAT
TTGGACAACAACTTTAAGATGCAACCGGCCAACAACTTTAGAATGCACCCAGCCAACAAC
TTTAGCATGCATTCATTTAATCCACATGGTTACCAAATGAATCGCGTCATGAACTAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MDFVQVSEEEGDEPIELPAEEDGTLLLSTLQAQFPGSCGLKYRNLDTKAVRGVRSNEGRLFPPSVESGWGEYAYFCVFPKENKRKSDDNLENSTAKTKRI
M.FV.VSE.EGDEPIELPAEEDGTLLLSTLQAQFP.S.GL.YRN.DTKAVRGVRSNEGRL..PS.E.GWGEY.YFCVFPK.NKR.S.DNLENSTAKTKR.
Retrocopy
MVFVHVSEKEGDEPIELPAEEDGTLLLSTLQAQFPESSGLQYRNVDTKAVRGVRSNEGRLYSPSEETGWGEYHYFCVFPKKNKRQSEDNLENSTAKTKRT


Parental protein
ETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRHLIDGRWCEVKVPNSKGMGHQVPCKVFVGRCT
E..LRC.DLIVLGL...TTE..LREYFETYG.V..A.IKKDT.SG.SKGFGFVRFGSYD.QM.VL..RH.IDGRWCEVKVP.S.GMG.Q.P.KVFVGRCT
Retrocopy
EAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVLSKRHSIDGRWCEVKVPASRGMGNQEPGKVFVGRCT


Parental protein
EDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRNQQVQSYNYNSA-NSFGMHSYHPQGN-HMNP
EDI..DDLREYFSKFGEV.DVFIP.PFRAFSFVTFLDP.V....CGE.HIIKGVSVHVS.A..K..QN.NQ..Q..NYN...N.F.M....P..N..M.P
Retrocopy
EDIEADDLREYFSKFGEVIDVFIPKPFRAFSFVTFLDPYVPRVVCGEKHIIKGVSVHVSTADKKNVQNKNQLFQTNNYNNLDNNFKM---QPANNFRMHP


Parental protein
GRNGHHRGNNQH
..N......N.H
Retrocopy
ANNFSMHSFNPH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide