RetrogeneDB ID:
retro_dmel_22
Organism:
Drosophila melanogaster ( Drosophila_melanogaster )
Location:
3R:24119855-24120191 (+)
Status:
KNOWN_PROTEIN_CODING
Ensembl ID:
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
85.59 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CG3560
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_dmel_22
ATGTCGAAATATGTGGCTAGAGTGGGCCCAGCGGTTTTCTCCAAGTTGGGAAAGTGGGCC
TACAACATGTCTGGATTCAACCAATACGGCCTGTATCGCGATGACTGTCTGTACGAGAAT
GAGGATGTGGCAGAAGCAGTGCGTCGTCTGCCCCGCAAACTGTACGATGAACGCAACTAT
CGCATTCTTCGAGCACTGCACCTTTCCATGACCAAGACGATCCTGCCCAAGGAGCAGTGG
ACCAAGTACGAGGAGGACATCAAGTACTTGGAGCCCTATCTTAACGAAGTGCAAAAGGAG
CGCGAAGAGCGTGAGGAATGGAGCAAAACTCATTGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSNYIARKGPAVLSNLGRWAYNLSGFNQYGLHRDDCLYENEDVKEAVRRLPRKLYDERNYRIMRALHLSMTKTILPKEQWTKYEEDVKYLEPYLKEVVKE
MS.Y.AR.GPAV.S.LG.WAYN.SGFNQYGL.RDDCLYENEDV.EAVRRLPRKLYDERNYRI.RALHLSMTKTILPKEQWTKYEED.KYLEPYL.EV.KE
Retrocopy
MSKYVARVGPAVFSKLGKWAYNMSGFNQYGLYRDDCLYENEDVAEAVRRLPRKLYDERNYRILRALHLSMTKTILPKEQWTKYEEDIKYLEPYLNEVQKE


Parental protein
REEREDWEKIH
REERE.W.K.H
Retrocopy
REEREEWSKTH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide