RetrogeneDB ID:
retro_dmel_23
Organism:
Drosophila melanogaster ( Drosophila_melanogaster )
Location:
3R:13550269-13550632 (-)
Status:
KNOWN_PROTEIN_CODING
Ensembl ID:
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
82.76 %
Coverage:
95.87 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
Atg8a
Parental gene aliases:
No gene alias available
Parental gene description:
Autophagy-specific gene 8a [Source:FlyBase gene name;Acc:FBgn0052672]

Genomic region (view in browser)





>retro_dmel_23
ATGGATATGAACTACCAGTACAAGAAGGACCACTCGTTCGACAAGCGCCGCAACGAAGGC
GACAAGATCCGGCGCAAGTATCCGGACCGTGTGCCCGTCATCGTGGAAAAGGCGCCGAAG
ACGCGTTACGCGGAGCTGGACAAGAAGAAGTACCTGGTGCCGGCGGACCTGACAGTGGGC
CAGTTCTACTTTCTCATCCGCAAGCGTATCAATCTGCGTCCCGACGACGCCCTCTTCTTC
TTCGTAAACAATGTGATCCCACCGACATCGGCCACCATGGGTGCACTGTACCAGGAGCAC
TTCGACAAGGACTACTTCCTCTACATTTCCTATACCGATGAGAACGTCTATGGACGGCAG
TAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHE
M..QYK..H.F.KRR.EGDKIRRKYPDRVPVIVEKAPK.R...LDKKKYLVP.DLTVGQFYFLIRKRI.LRP.DALFFFVNNVIPPTSATMG.LYQEH..
Retrocopy
MNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVGQFYFLIRKRINLRPDDALFFFVNNVIPPTSATMGALYQEHFD


Parental protein
EDYFLYIAYSDENVYG
.DYFLYI.Y.DENVYG
Retrocopy
KDYFLYISYTDENVYG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide