RetrogeneDB ID:
retro_dmel_24
Organism:
Drosophila melanogaster ( Drosophila_melanogaster )
Location:
3L:4648671-4650135 (+)
Status:
KNOWN_PROTEIN_CODING
Ensembl ID:
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
59.81 %
Coverage:
82.66 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CG8918
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_dmel_24
ATGGCCGTTGTTTGGGACATGAGTCAATGGACGCAGGCGTGGCGGATCGACAGTCTGCAT
CCGACGGTCCGCTCGAGCGGTACAAGAACCACAACGAGCGGTACAATCATGTACGGTCGC
ACGTCGGTCGGTGCAAATCAATCCGTGACGAATGGCAACTCAAATAGTGGCGCAAATAGC
GGCGGTGGTGCCAGTGGTGGTGCCCAGGGACACGATAAACTGAAAATTGGCTTCTGCACG
GACCTGGATAAATCGGTTTTGGTCAACAATTTCGAGAAACGTGGCTGGCATCAGGTGAAT
GGCGATGATGATTGGCATTTCTATTGGGCCGGAGTGCAAACCTGCCGGAATATATTCAGT
GTGGATAGTGGTTATAGGATGCACGATAACCAGATGATCAATCATTTTCCCAATCACTAT
GAATTATCACGCAAGGATTTACTGGTCAAGAACATCAAGCGTTATCGCAAGGATCTCGAG
AGGGATGGCAATCCATTGGCGGAGAAAACAGAGTCCAATAACTCCAGTGGCACCAGATAT
CTTTATTTGGATTTTGTGCCAACAACTTTTGTCCTGCCAGCCGATTATAATATGTTCGTG
GAGGAGTATCGCAAGTTTCCGCTGAGTACGTGGATTATGAAACCCTGTGGAAAATCCCAA
GGAGCGGGTATATTCCTTATAAACAAACTATCCAAACTCAAGAAGTGGTCAAGAGAGGCC
AAGGGTCCTTTTCATCCACAAATAGCCAAGGAATCGTATGTGATATCCAGATACATAGAC
AATCCACTATTGATTGGTGGTAAAAAATTTGATCTTCGTCTATATGTTCTAGTCGCTTCG
TTCAGACCCCTGAAAGCTTATCTTTTTAAGCAGGGATTCTGCCGTTTTTGTACTGTAAAA
TACGATACTAGTGTTACGGAACTGGATAATATGTACGTCCATCTGACAAATGTGAGTGTG
CAGAAACATGGTGGCGAATACAATACCCTACATGGTGGCAAGTGGTCTGTACAAAATCTG
GCCCTCTATTTGGAAGGAACTCGGGGAAAAGAGGTTACGGATCGTTTGTTTGGAGCCATA
TCCTGGCTTATAGTACACTCCTTAAGAGCTGTGGCTCCTGTGATGGCCAGTGATAGGCAT
TGTTTTGAGTGTTATGGCTACGACATCATCATAGACAATGCCTTGAAACCTTGGCTAGTG
GAGGTGAATGCCTCACCGTCACTCACATCAACTACAGTAAACGACAGGATACTAAAATAC
AAACTGATTGACAACATACTGTCCGTGGTCCTACCCCCCGATGGAGTGCCCGATGTGCGT
TGGAATAAGGTTCCCAGTGCCGATGCTTTGGGCAACTTTGAGCTGCTCATCGATGAGGAG
TTGGCCGCCCAGGATGAACAACACCAAAATAGCAGCAGCAACACTCATAGTAAAACATCC
AAAATGGGCAGCCGATGGAAGTGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IYYSTDWDKSALVSNFQKRGWLQVPSFNGEWNFYWACTQNCRYIFGIDHPYRMRSDQVINHFPNSIELSRKDLLIKNIKRYRKDLERRGDPLAQSHPPDT
I...TD.DKS.LV.NF.KRGW.QV......W.FYWA..Q.CR.IF..D..YRM...Q.INHFPN..ELSRKDLL.KNIKRYRKDLER.G.PLA.......
Retrocopy
IGFCTDLDKSVLVNNFEKRGWHQVNG-DDDWHFYWAGVQTCRNIFSVDSGYRMHDNQMINHFPNHYELSRKDLLVKNIKRYRKDLERDGNPLAEKTESNN


Parental protein
KLGIGGTRYKHLDIIPMTFVLPSDYQMFVEVFHRNPASTWIVKPCSKSQGVGIYLVNKLSKLKKFAYDAR-TFYPQINRDTCVISKYIDNPLLIGGKKFD
.....GTRY..LD..P.TFVLP.DY.MFVE.....P.STWI.KPC.KSQG.GI.L.NKLSKLKK....A...F.PQI.....VIS.YIDNPLLIGGKKFD
Retrocopy
S---SGTRYLYLDFVPTTFVLPADYNMFVEEYRKFPLSTWIMKPCGKSQGAGIFLINKLSKLKKWSREAKGPFHPQIAKESYVISRYIDNPLLIGGKKFD


Parental protein
LRLFVLVTTFNPLKAYLYKEGFCRFCTEKYDE--TEIDNVFMHLTNVSIQKTNQEYNSIHGGKWPLQNLWLYLDSLRGEGVSDMLWSRITATIRHSLDAV
LRL.VLV..F.PLKAYL.K.GFCRFCT.KYD...TE.DN...HLTNVS.QK...EYN..HGGKW..QNL.LYL...RG..V.D.L...I...I.HSL.AV
Retrocopy
LRLYVLVASFRPLKAYLFKQGFCRFCTVKYDTSVTELDNMYVHLTNVSVQKHGGEYNTLHGGKWSVQNLALYLEGTRGKEVTDRLFGAISWLIVHSLRAV


Parental protein
APVMANDRHCFEVYGYDIIIDNNLKPWLIEINTSPSMHSTTTNDRMLKSRLIDNVLDVVVPPNCMPNEHWDKTPNPELLKNFTVLMPISPCKPKEQVPVR
APVMA.DRHCFE.YGYDIIIDN.LKPWL.E.N.SPS..STT.NDR.LK..LIDN.L.VV.PP...P...W.K.P....L.NF..L.........EQ....
Retrocopy
APVMASDRHCFECYGYDIIIDNALKPWLVEVNASPSLTSTTVNDRILKYKLIDNILSVVLPPDGVPDVRWNKVPSADALGNFELLIDEELAAQDEQHQNS


Parental protein
RKGRLSKKKKSKS
.....SK..K..S
Retrocopy
SSNTHSKTSKMGS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide