RetrogeneDB ID:
retro_dmel_33
Organism:
Drosophila melanogaster ( Drosophila_melanogaster )
Location:
X:12070927-12072640 (-)
Status:
KNOWN_PROTEIN_CODING
Ensembl ID:
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
81.54 %
Coverage:
53.72 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
Cnx99A
Parental gene aliases:
No gene alias available
Parental gene description:
Calnexin 99A [Source:FlyBase gene name;Acc:FBgn0015622]

Genomic region (view in browser)





>retro_dmel_33
ATGGCATGGAAAATTGGAGGAAATCAGTACGCAACACTGTCGATGCTCTTCGCCAGCAGT
TTGCTATTGCTGAGTGCGGTCAAAGCCATCGATTCGGATCTAGAGTGGGATGACTTCGAG
GACGTTGATGTAGAGGATGTGCAGCAGGAGGATGTCGATGAGAAGCCTACCTATAAGAGC
CCGGTGATCGATGCCAAGAAATTCCACTTCGCGGACCACTTCGACGACATGGAGGCATCC
ACAAGGAGGTGGGTACTCTCGCAGGCCAAGAAGGACGACATCGCCGATGAGATCTCCAAG
TACGATGGCATCTGGAATTGGGAGCCGCCGCAGCGCATGGTTTGGGCAAACGATCTGGGT
CTGGTGCTCAAGTCGAAGGCCAAACATGCGGCCATAGCAGCCCACCTTCATCAGCCGTTC
GATTTCAAGTCGGAGAAGCCACTGGTGGTGCAGTATGAGATTACGATTCAGAAGGGTCAG
GAGTGCGGCGGCTCGTATCTAAAGCTTTTGTCCGCCGGAAAAGAGACGGAACAACTACAG
ACCTTCAATGACAAGACACCCTATACCATTATGTTTGGACCGGACAAGTGCGGCAAAGAT
GTGACAATTCACTTTATATTCAAGCACGTCAATCCAATTAATGGCACCATCACCGAGAAG
CATTGCAACAAGCCAAATAATAGTTTTGAAGAGCCATTCAAGGATAAGTTACCCCATCTC
TATCAGCTGGTGGTTCGTCCAGATAACAGCTTTGAAATTCGCATTGACCACAAGATCATC
AAAGAGGGTTCCCTGCTAACCGATTTCAAGCCACCAGTCAATCCGCCGGCAGAGATCGAT
GACCCCAATGACCATAAGCCAGATTCGTGGGATGAGCGAGAGAAGATCCCAGACCCCACT
GTTCACAAGCCCGAGGATTGGGACGAGAATGAAACACTAAAGCTGCCAGATGCCGACATG
ATTTTTGATCCAACTGCCACGAAACCTGAAGATTGGGATGACGAAATCGATGGCGAGTGG
CAGGCTCCAATGGTAGACAACCCAGTGTGCAAGAAGGACCAAACCTGTGGCATCATCCGC
AATCCCAACTACAAGGGCAAGTGGATTGCACCGATGATCGATAACCCAAACTACCAGGGC
AAGTGGGCACCCAGAAAGATTGCCAATCCAGACTTCTTTGAGGATCTCAAGCCCTTTCAA
ATGACGCCCATCAGCGCTGTGGGTCTGGAGCTGTGGTCCATGTCCAGTGATATTCTCTTC
GACAACCTGATCATCACAGACGACGTGGAGGTGGCCCGTGACTTTGCGGCCAACAGCTTT
GACATCAAGCGTCGCTACATCGATCGTGAACGGGACTCAATCGTGAATAAGGTAGTCGAG
CTAGTCAAGGACTATCCCTCGATTTGGGCCATTGGCCTGGTGGCCATTGTGGCGTTGGTT
GCCCTCACTAAATGCTGTAGATTTGGTACCACTAAGATTCAGGAATCGGCTGCTGCCGAG
TCCAAGAAGACCGACGATCCTCAGCCCCATGAGCCGAGGCCGTGGGGGAGTAGGATGAGC
AGAGCGAAGAAATGGAAGTTGACGATACCACCAAGAAGAGCATATAGCTGTCCGTTACCA
CCCAAAAAGAAATTAGATGACAACGAATGGAAGTTCAAGGCGGCGAAGAAACAAAAGCAC
ACACAGACTAAGGAATCTAACACTGAGGAGTAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAWKMGGNRAATLALLFASSLLLLSAANAADLDTESDDFEDGYVEDVQEEPAVIGGDEKLAYESPVIDAKKFHFADHFDDVEESRKRWVLSQAKKDDIAE
MAWK.GGN..ATL..LFASSLLLLSA..A.D.D.E.DDFED..VEDVQ.E......DEK..Y.SPVIDAKKFHFADHFDD.E.S..RWVLSQAKKDDIA.
Retrocopy
MAWKIGGNQYATLSMLFASSLLLLSAVKAIDSDLEWDDFEDVDVEDVQQEDV----DEKPTYKSPVIDAKKFHFADHFDDMEASTRRWVLSQAKKDDIAD


Parental protein
EISKYDGIWNWESPQRIVWANDLGLVLKSKAKHAAIAAPLRKPFEFKSDKPLVVQYEVTLQEGQECGGSYLKLLSAGKDTEQLKAFNDKTPYTIMFGPDK
EISKYDGIWNWE.PQR.VWANDLGLVLKSKAKHAAIAA.L..PF.FKS.KPLVVQYE.T.Q.GQECGGSYLKLLSAGK.TEQL..FNDKTPYTIMFGPDK
Retrocopy
EISKYDGIWNWEPPQRMVWANDLGLVLKSKAKHAAIAAHLHQPFDFKSEKPLVVQYEITIQKGQECGGSYLKLLSAGKETEQLQTFNDKTPYTIMFGPDK


Parental protein
CGNDVKMHFIFRHVNPINGTITEKHCNKPKNRLEEPFKDKLPHLYQLVVRPDNSFEIRVDHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKI
CG.DV..HFIF.HVNPINGTITEKHCNKP.N..EEPFKDKLPHLYQLVVRPDNSFEIR.DHKII.EGSLLTDFKPPVNPPAEIDDPNDHKP.SWDEREKI
Retrocopy
CGKDVTIHFIFKHVNPINGTITEKHCNKPNNSFEEPFKDKLPHLYQLVVRPDNSFEIRIDHKIIKEGSLLTDFKPPVNPPAEIDDPNDHKPDSWDEREKI


Parental protein
PDPTAHKPEDWDEDAPPQLPDTDAV
PDPT.HKPEDWDE.....LPD.D..
Retrocopy
PDPTVHKPEDWDENETLKLPDADMI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide