RetrogeneDB ID:
retro_dmel_40
Organism:
Drosophila melanogaster ( Drosophila_melanogaster )
Location:
2L:17554438-17555611 (-)
Status:
KNOWN_PROTEIN_CODING
Ensembl ID:
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.62 %
Coverage:
94.96 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CkIalpha
Parental gene aliases:
No gene alias available
Parental gene description:
Casein kinase Ialpha [Source:FlyBase gene name;Acc:FBgn0015024]

Genomic region (view in browser)





>retro_dmel_40
ATGGCAAAACAAGAAGCAACAAATGGGAAAGTTCGTAATGCATCTCTTCATCTGGAGAAG
CTGTTGATCGGGGGAAAATATCGGCTGGTAAAGCCCATTGGGTCCGGGTCCTTCGGCGAT
ATATATCTCGGACTAAGCATCACGGATGGATCCGAGGTGGCCATTAAGGTGGAGAAGAAC
GATGCCAAGTACCCGCAGCTGATATACGAGGCGAAAGTGTACGAACAGCTGGCCCGCTGT
CCGGGCTTCCCGACTCTACTTCATTATGGATGCGAGAAGAACTATAATGCCATGGTTATG
GACCTATTAGGTCCTTCCCTAGAAGAACTTTTTAACCTCTGCAAACGCCGATTCTCGCTG
AAGACCGTACTCATGTTGACAGACCAGCTGCTAATGCGAATTGAGTGTGTCCACGAACGT
GGGTTCATTCATCGTGACATTAAACCAGATAACTTCCTAATGGGTCTGGATCGCCACTGC
AACAAGCTGTACCTCATCGATTTTGGCCTGTCCAAGAGATACAAGGACATAGAGTCAGAG
ATTCATATACCATACCGCACGGATCGGAATCTAACTGGTACTGTTCGCTATGCCTCTATA
AATGCACAGATAGGCGTTGAGCAATCCCGTCGGGATGACATGGAGTCCATGTCCTATTGT
TTGATGTACTTCAATCTGGGAAAGTTACCCTGGCAGGGTATTACGGCCGCCAACAAGAAG
CAAAAGTACGAGAAGATATTGGAGAAAAAGACAAGCGTCACGATCGCTCAGCTCTGCAAA
GGATTTCCCTCCGAATTTTGCCTGCTTATGACCTATGTCAGGAATCTTGGTTTCAAGGAG
CCGCCGGATCACACTTATCTTCGCCAGATATTCCGCATACTTTTCCGCTCACTGAATCAT
CATTACGACTATATATATGACTGGACTGCCTTGCAGCAGCAAAAGGATCAAATCTGCCGC
AGCAGGGAACAGATTCTGGAATCGGAACGAGAAGAGGTCCGCAAACGGGATGGGGAACGG
GGTTGTGAGCCTCAGCGGGACAAGGAGCGGCACAAGGATTTGGAGCTGGATCGACTGCAC
AAAACTTCCACCCAACAGGCAAAGTGCTCTAATGGACATCTAACAAACCGATATGATCGC
ATTGGCGATGGAGGCATTAGCAAGCGAAAGTAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EIIVGGKYRVIRKIGSGSFGDIYLGMSIQSGEEVAIKMESAHARHPQLLYEAKLYRILSGGVGFPRIRHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFT
....GGKYR....IGSGSFGDIYLG.SI..G.EVAIK.E...A..PQL.YEAK.Y..L....GFP...H.G.EKN.N..VMDLLGPSLE.LFN.C.R.F.
Retrocopy
KLLIGGKYRLVKPIGSGSFGDIYLGLSITDGSEVAIKVEKNDAKYPQLIYEAKVYEQLARCPGFPTLLHYGCEKNYNAMVMDLLGPSLEELFNLCKRRFS


Parental protein
IKTVLMLVDQMIGRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGIEQSRRDDMESLGY
.KTVLML.DQ...R.E..H...FIHRDIKPDNFLMG..RHCNKL.LIDFGL.K...D.....HI.YR.D.NLTGT.RYASINA..G.EQSRRDDMES..Y
Retrocopy
LKTVLMLTDQLLMRIECVHERGFIHRDIKPDNFLMGLDRHCNKLYLIDFGLSKRYKDIESEIHIPYRTDRNLTGTVRYASINAQIGVEQSRRDDMESMSY


Parental protein
VMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVLCKGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKTHQGQ
..MYFN.G.LPWQG..A..K.QKYEKI.EKK.S..I..LCKG.P.EF.....Y.R.L.F.E.PD..YLRQ.FRILFR.LNH.YDYIYDWT.L.Q...Q..
Retrocopy
CLMYFNLGKLPWQGITAANKKQKYEKILEKKTSVTIAQLCKGFPSEFCLLMTYVRNLGFKEPPDHTYLRQIFRILFRSLNHHYDYIYDWTALQQQKDQIC


Parental protein
PNPAILLEQLDKDKEKQNGK
......LE.......K..G.
Retrocopy
RSREQILESEREEVRKRDGE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide