RetrogeneDB ID:
retro_dmel_55
Organism:
Drosophila melanogaster ( Drosophila_melanogaster )
Location:
3L:358030-358399 (+)
Status:
KNOWN_PROTEIN_CODING
Ensembl ID:
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.68 %
Coverage:
99.07 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
Roc1a
Parental gene aliases:
No gene alias available
Parental gene description:
Roc1a [Source:FlyBase gene name;Acc:FBgn0025638]

Genomic region (view in browser)





>retro_dmel_55
ATGGCCGAGGAGATAGAGGTTGAGGAGACGGAGGACTTCCACGACATGGACTTCAATGAC
GAAGAGCCATCCTGTAGTGGAGGAGCTGTCCAGGCCAGGACGGAGCGCTTTGTGGTGAAG
AAATGGGTTGCGCACGCCATGTGGGGATGGGACGTAGCAGTGGACAACTGTGCCATCTGC
CGTAACCACATCATGAACCTGTGCATCGAGTGCCAGGCGGACCCGAATGCAAACCAAGAC
GAGTGCACTGTGGCTTGGGGCGAGTGCAACCACGCATTCCATTACCACTGCATCGCGCGC
TGGTTGAAAACGCGCCTGGTCTGTCCGCTGGACAACAAGGAGTGGGTCTACCAGAAGTAC
GGCCGCTAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MEVDEDGYEVPSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNRE
M...................RF.VKKW.A.A.W.WD..VDNCAICRNHIM.LCIECQA....A...ECTVAWG.CNHAFH.HCI.RWLKTR.VCPLDN.E
Retrocopy
MDFNDEEPSCSGGAVQARTERFVVKKWVAHAMWGWDVAVDNCAICRNHIMNLCIECQADP-NANQDECTVAWGECNHAFHYHCIARWLKTRLVCPLDNKE


Parental protein
WDFQKYG
W..QKYG
Retrocopy
WVYQKYG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide