RetrogeneDB ID:
retro_dmel_69
Organism:
Drosophila melanogaster ( Drosophila_melanogaster )
Location:
2R:13636522-13637560 (+)
Status:
KNOWN_PROTEIN_CODING
Ensembl ID:
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.45 %
Coverage:
83.93 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
wds
Parental gene aliases:
No gene alias available
Parental gene description:
will die slowly [Source:FlyBase gene name;Acc:FBgn0040066]

Genomic region (view in browser)





>retro_dmel_69
ATGGAATTGATTGAAACAGCTTCGACTCCTGGAGATTCCGAAACTGAAATCGCCATCCCG
GAGGCCGCTTTCGATTCCTTTAAGATGCCTATGCTACCAAGTCAGTTCCATTTGGAGAAC
TCCATGTCTCCGGGCTACGCCATTAAGCACTCGCTCCTCGGTCACAGTGGTTGCGTTACT
GGTCTAAAGTTTAGTTCGAATGGCGAGAACTTGGTCAGCAGCTCCGGCGATAGGCTGCTT
AAGCTCTGGGACTTGAGCGCAACCCGATGCATTCAATCGCTGGCCGGGCACGGAGACGGA
GTCAACGATGTCGCCTGGTCGGCGGCTGGATTAATTGCCAGTTGTAGCGATGACATGACC
GTGCGTCTCTGGGATGCCCGCAGCAAGCTCTGCGTCAAAGTTTTGGAGGGGCATTCCAGG
TACAGTTTCTCCTGCTGCTTTAATCCGCAGGCCAATCTGCTGGCCTCCACTAGCTTTGAC
GAAACAGTGCGCCTTTGGGATGTCCGCACTGGCAAAACGCTCAAAATCGTCCACGCCCAC
CAGGATCCCATAACATCGGTGGACTTCCACCGCGATGGCAATATTTTTGTCACCAGCAGC
TATGATGGGCTGGTCCGCTTGTGGGACTCTAGCACCGGGCATGTGCTGAAGACTCTCGTT
GACGTTGACAACATCCCGGTCGGATATGTGAAGTTCTCACCGAACGGACGCTACATCCTG
TCGTCCACATTGAACAACACCCTTAGGCTATGGAACTACAAGAAGCCCAAGTGCATGAGG
ACCTATCGCGGGCATTTGAATGAGTTCTATTGCTCCAACTCCAATTTTTCCACCACCGGC
GGCATTTGGATTGTCTCCGGCAGCGAGGATAATACGCTTTGCATCTGGAATCTGCAGACG
AGGGAGCTGGTGCAAAAGATAAGCACGGAGGGCGACCAGATTTTGAGCACACATTGCCAT
CCCACGGCAAATGTGATTGCTAGCGGCGCCCTACAAAATTCATATGCCATTAAAATCTGG
AAGAGCAGCGAGAAGTAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SVKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHS
S..P.Y..K..L.GH...V...KFS.NGE.L.SSS.D.L.K.W............GH..G..DVAWS....L..S.SDD.T...W........K.L.GHS
Retrocopy
SMSPGYAIKHSLLGHSGCVTGLKFSSNGENLVSSSGDRLLKLWDLSATRCIQSLAGHGDGVNDVAWSA-AGLIASCSDDMTVRLWDARSKLCVKVLEGHS


Parental protein
NYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYI
.Y.F.C.FNPQ.NL..S.SFDE.VR.WDVRTGK.LK...AH.DP...V.F.RDG...V.SSYDGL.R.WD...G..LKTL.D.DN.PV..VKFSPNG.YI
Retrocopy
RYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTLKIVHAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGHVLKTLVDVDNIPVGYVKFSPNGRYI


Parental protein
LAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKL
L..TL.NTL.LW.Y.K.KC..TY.GH.NE.YC...NFS.TGG.WIVSGSEDN...IWNLQ..E.VQK.....D..L.T.CHPT.N.IAS.AL.N...IK.
Retrocopy
LSSTLNNTLRLWNYKKPKCMRTYRGHLNEFYCSNSNFSTTGGIWIVSGSEDNTLCIWNLQTRELVQKISTEGDQILSTHCHPTANVIASGALQNSYAIKI


Parental protein
WKS
WKS
Retrocopy
WKS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide