RetrogeneDB ID:
retro_dmel_72
Organism:
Drosophila melanogaster ( Drosophila_melanogaster )
Location:
2L:22079687-22080719 (+)
Status:
KNOWN_PROTEIN_CODING
Ensembl ID:
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
61.63 %
Coverage:
60.28 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
ttm50
Parental gene aliases:
No gene alias available
Parental gene description:
tiny tim 50 [Source:FlyBase gene name;Acc:FBgn0250874]

Genomic region (view in browser)





>retro_dmel_72
ATGCATAAAATTGTTTGGTTTGGAACTTTAAATAAGTCGATTGGCTACATCGGTAAAAAG
AAGACCTGTCTTCTGAGTCCATGCGAGAAAATATGCCTGAATTCAGCTAGAAAAACAGTA
CAGAGATGCGACAAAAACTATTCACCACCAAAGTTAAGAAGAATCAAGAATTTCTATACC
TACAGTGTTGTGTTGGGGAGTCTCTTCAGTATAGTCATGTGGGCCATCTATAAGCTGGGC
AAGCCCGAGGAAGACCATCGGGGTCCCATAGAAGATGAGTTCAGTCAGCTTCCCTGGTTC
CGCCAGTACATAATGAGGATGTGGCACACACTTCAGTATTATGAAAAAATGATGGAAGAG
CCCCAGATGGCAAGGCTGCTGCCAAATGTTGTCCCACCGCCGTATATACAACCTCCCTAT
TCACTGGTGCTGGAAATCAAAGACGTACTGGTGCATCCAGATTGGACTTATCAGACGGGG
TGGCGGTTTAAAAAGCGGCCTGGTGTGGATTACTTTCTTCAGCAGTGCAGTCGAAATTTT
GAAATTGTGATATATACTTCTGAACAAGGTATGACCGCATTCCCCCTTCTGGATGCTTTA
GATCCCTATGGCTACATAAAATATCGGCTAGTAAGAGGTGCCACGGACTTGGTAGAGGGT
CAGCATACCAAGAACCTCGATTATCTTAACAGGGATCTGAGCCGTGTGATAGTGGTGGAC
TGTGATCCGTATACCACTCCCCTGCATCCCGATAATAGCTTGGTGCTCACAAAGTGGCTG
GGTAACGATGATGATGTCCAGCTCTTTGATCTCACGGCTTTCCTGCAGTTGATTGCCGAA
CACCAAGTAAATGATGTAAGGGAGGTGCTGCGATACTATCGCCAATTCGAGGACCCCATG
GAACAGTTTAAGGACAACCAACGTCGACTGCAGGAGCAGAGTCAGGAAAGCATTCAGAAT
TTACCAACTAGTGAACGTCAGTGGAACTTAACTTTATTGGGACGCTCCCTTCGAGGGTCT
TCAATCAAATAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FAIFGGSAVAAGFWAVYEFGKPEVDPNGQPIEDEFTHKPLVQQYLQRMWKSIHYYQRMIQEPSRAKLLPDPLKPPYVQPRYTLVLEMKDVLVHPDWTYQT
.....GS......WA.Y..GKPE.D..G.PIEDEF...P...QY..RMW....YY..M..EP..A.LLP....PPY.QP.Y.LVLE.KDVLVHPDWTYQT
Retrocopy
YSVVLGSLFSIVMWAIYKLGKPEEDHRG-PIEDEFSQLPWFRQYIMRMWHTLQYYEKMMEEPQMARLLPNVVPPPYIQPPYSLVLEIKDVLVHPDWTYQT


Parental protein
GWRFKKRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPNGYIMYRLVRDATHFVDGHHVKNLDNLNRDLKKVIVVDWDANATKMHPDNTFGLARW
GWRFKKRPGVD.FL..C...FEIV..T.EQGMT.FP.LDALDP.GYI.YRLVR.AT..V.G.H.KNLD.LNRDL..VIVVD.D...T..HPDN...L..W
Retrocopy
GWRFKKRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDALDPYGYIKYRLVRGATDLVEGQHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKW


Parental protein
HGNDDDGQLLDLIAFLKIIAQNNVDDVREVLHYYRQFDDPINQFRENQRKLAEQMLEA
.GNDDD.QL.DL.AFL..IA...V.DVREVL.YYRQF.DP..QF..NQR.L.EQ..E.
Retrocopy
LGNDDDVQLFDLTAFLQLIAEHQVNDVREVLRYYRQFEDPMEQFKDNQRRLQEQSQES


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide