RetrogeneDB ID:
retro_dmel_78
Organism:
Drosophila melanogaster ( Drosophila_melanogaster )
Location:
3L:11016638-11017706 (+)
Status:
KNOWN_PROTEIN_CODING
Ensembl ID:
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.45 %
Coverage:
91.12 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
desat1
Parental gene aliases:
No gene alias available
Parental gene description:
desat1 [Source:FlyBase gene name;Acc:FBgn0086687]

Genomic region (view in browser)





>retro_dmel_78
ATGCCACGCAATACCAAAGACACCACCGGAGTGCTTTACGAATCCGATGTCGAGACAGTA
GACGGTGGATTGTCGACGGAGCTAAGCAATCGGAAGACCACCGATGGAAGTAAACTGGAG
TTGGTATGGGTCAATATAGTGCTGTTCGTGATCCTTCACATATCTTCGCTATATGGAGTC
TGGCTGCTCTTCACTTCGGCCACGTGGACAACGGTCGTGCTCTTTTGGCCAACGGTTGTG
GTGACCATTTTGGGAGTTTCCGGCGGTGCCCATCGTTTGTGGGCTCATCGCACATTCAAG
GCGAATACACCGCTCAAGCTGATCTTTTTGTTCCTGAACACTTTGGCCTTTCAGGATGCG
GTCTACTATTGGGCCCGGGATCATCGCGTCCACCACAAGTATACGGAAACTGATGCGGAT
CCGTACAATTCGCAACGTGGTTGGTTCTTTGCCCACATCGGTTGGTTGTGCTGCCGCAAG
CATCCGGAGGTTGTGGAGAAGGGCAAGCAAATAGATCTATCCGATCTGGAGGCAGATCCA
CTGATCATGTTCCAGAAGAAATACTACCTGCTGCTAATGCCAATCATTTGCTTTGTCCTG
CCCACCGTTTTGCCCATGTATCTGTGGGGCGAATCACTCAATGTGTCCTGGCACGTGATG
GCCCTGCTTCGATGGTGCCTCAGTCTCAATCTCATCTGGACGGTCAATAGCTCGGCCCAC
ATGCACGGCATGCGGCCTTACGACAAGAACATATGTCCAGTCGATCAGGGCTTCCTCATA
TTTTTCCGTGTGGGTGAGGGATACCACAACTACCACCATGTCTTTCCCTGGGACTACAAG
AGCGCCGAGCTGGGCAAGTATTCGCAGGATGTGACCACCAAGTTTATCGAATTCATGGCC
TATTTGGGTTGGGCCTACGATCTAAAGAGTGTCTCACTGGATTTGGTCAAGCAGCGAGTC
CAGCGCTCTGGCGATGGATCACATCCTGTTTGGGGTTGGGGCGATAAGGATCAATTAAAG
GAGGACGTGGGCGTGACCACCATTACCCACCAGCGAAATGAAAAGTAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EDSTGVLFECDVETTDGGLVKDITVMKKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAHRLWAHRSYKAKWPL
.D.TGVL.E.DVET.DGGL.......K......L.LVW.NI..F..LH...LYG..L..TSA.W.T..L.....V...LG...GAHRLWAHR..KA..PL
Retrocopy
KDTTGVLYESDVETVDGGLSTELSNRKTTDGSKLELVWVNIVLFVILHISSLYGVWLLFTSATWTTVVLFWPTVVVTILGVSGGAHRLWAHRTFKANTPL


Parental protein
RVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVP
..I....NT.AFQDA.Y.WARDHRVHHKY.ETDADP.N..RG.FF.H.GWL.C.KHPEV..KGK..DLSDL.ADP..MFQKKYY..LMPI.CF..PTV.P
Retrocopy
KLIFLFLNTLAFQDAVYYWARDHRVHHKYTETDADPYNSQRGWFFAHIGWLCCRKHPEVVEKGKQIDLSDLEADPLIMFQKKYYLLLMPIICFVLPTVLP


Parental protein
MYAWGESFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNYHHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWA
MY.WGES....W.V....RWC..LN..W.VNS.AH..G.RPYDK.I.P...........GEG.HNYHHVFPWDYK.AE.GKYS...TT.FI.F.A..GWA
Retrocopy
MYLWGESLNVSWHVMALLRWCLSLNLIWTVNSSAHMHGMRPYDKNICPVDQGFLIFFRVGEGYHNYHHVFPWDYKSAELGKYSQDVTTKFIEFMAYLGWA


Parental protein
YDLKTVSTDIIKKRVKRTGDGTHATWGWGDVDQPKEEIEDAVITHKKSE
YDLK.VS.D..K.RV.R.GDG.H..WGWGD.DQ.KE......ITH...E
Retrocopy
YDLKSVSLDLVKQRVQRSGDGSHPVWGWGDKDQLKEDVGVTTITHQRNE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide