RetrogeneDB ID:
retro_dmel_79
Organism:
Drosophila melanogaster ( Drosophila_melanogaster )
Location:
X:6236170-6237391 (+)
Status:
KNOWN_PROTEIN_CODING
Ensembl ID:
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
54.97 %
Coverage:
92.62 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
CG2070
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_dmel_79
ATGTCGGAGGCTGCCACGCCCCCAGGATCAGTGCCAGGAACAGTATTCCCACCTGGCTTC
GATCCCACTGCCGAATCGGTGGAGAAGACTCTCTGCTTCCGGGGTTTCTGGGCCTGGGCC
GTGCTGATATTCCTGATTGTTCTGGGCATATTGCTCTTCATGTGGCTGCTGCGCAAGTGC
ATCCAAGGACCGGCCTACCGGAAGGCCAATCGCATCGATGGCAAGGTGGTCATCGTCACC
GGCTGCAACACGGGCATTGGCAAGGAGACGGTCCTCGAGTTGGCCAAGCGGGGTGCCCGC
GTCTACATGGCCTGTCGGGATCCCGGTCGGTGTGAGGCCGCACGACTGGATATCATGGAT
CGCAGTCGCAACCAGCAGCTCTTCAATCGCACCCTGGATCTGGGCTCCCTGCAGTCGGTG
AGAAATTTCGTGGAGCGCTTCAAGGCGGAGGAATCCCGGCTGGATATACTGATCAATAAT
GCCGGCGTTATGGCCTGTCCCAGGACCCTCACAGCCGATGGCTTTGAGCAGCAGTTCGGT
GTCAATCATCTGGGACACTTTTTGCTCACGAATCTGCTGCTGGATCGACTGAAGCACAGC
TCGCCCAGTCGCATTGTGGTGGTCAGTTCGGCGGCACATCTCTTTGGGCGAATCAACCGC
GAGGATCTGATGAGCGAGAAGAACTACAGCAAGTTCTTTGGGGCGTACAGTCAGTCCAAG
CTGGCCAACATCCTGTTTACCCTCAAGCTGAGCACCATCCTTAAGGACACCGGCGTAACG
GTGAACTGTTGTCATCCGGGTGTGGTCCGCACCGAGATCAACCGCCACTTTTCCGGTCCC
GGCTGGATGAAGACCGCCCTGCAGAAGGGCTCGCTGTACTTCTTTAAGACACCCAAGGCT
GGCGCCCAGACCCAGCTGAGATTGGCGCTGGATCCGCAGTTGGAGGGCTCCACTGGTGGC
TATTACTCGGACTGCATGCGCTGGCCATTGTTTCCGTGGGTCCGGAATATGCAGACCGCC
GACTGGTTGTGGCGAGAGAGCGAGAAGCTGCTGGGTCTGCCACCGCTGGAGCCACCTCCA
CCTGTCCAGAGCCCCACCCAGAATGGCAATGGCACTCAAAACGGCAATGGTAGTTCCAGT
GCCAGTGCCAGTGCCAGTAGTAACAATCCCGCTTCACGGGAAATGCAATCCGTGGAAACG
GTCGTGGTCAATCGTTCGTAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IYLLRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREIIKATNNQNIFARQLDLCSMKSIRNFAAGFKREQNK
..LLR...QG..........G.V.IVTGCN.GIGKETVLELA.RGA.VYMACRD...CE.AR..I.....NQ..F.R.LDL.S..S.RNF...FK.E...
Retrocopy
MWLLRKCIQGPAYRKANRIDGKVVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRNFVERFKAEESR


Parental protein
LHILINNAGIMDCPKMLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDDLNSEKSYDRKM-AYCQSKLANVLFTRELAKR
L.ILINNAG.M.CP..LT.DGFE.Q.GVNH.GHFLLT.LLLD.LK.S.PSR.VV.SS.AH.FGRI.R.DL.SEK.Y.....AY.QSKLAN.LFT..L...
Retrocopy
LDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRIVVVSSAAHLFGRINREDLMSEKNYSKFFGAYSQSKLANILFTLKLSTI


Parental protein
LSGTGVTVNALHPGVVNTELFRNTPFLGSWFGKLLIAPIIWIFIKTARNGAQTTLYAALDPSLEKVSGRYFSDCKQKHVGSAAQYDDDAQFLWAESEKWT
L..TGVTVN..HPGVV.TE...N..F.G....K.........F.KT...GAQT.L..ALDP.LE...G.Y.SDC..............A..LW.ESEK..
Retrocopy
LKDTGVTVNCCHPGVVRTEI--NRHFSGPGWMKTALQKGSLYFFKTPKAGAQTQLRLALDPQLEGSTGGYYSDCMRWPLFPWVRNMQTADWLWRESEKLL


Parental protein
GI
G.
Retrocopy
GL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide