RetrogeneDB ID:
retro_ecab_1001
Organism:
Horse ( Equus_caballus )
Location:
8:79540228-79540437 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
65.28 %
Coverage:
59.17 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
PSME1
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) [Source:HGNC Symbol;Acc:9568]

Genomic region (view in browser)





>retro_ecab_1001
CCAATGAATGGCAAGAAGATGGTGGTCGTCCTGCAGCGTCTCAAGCCTGGAACTAGGCCT
GTCATTGAGCAGTCAGTCTGGTCACTATCTGGTTGCCGCTGCAGATACCTTGGCTTGAGG
ATGGGAACAGTTTTGGAATGGCTGTGCAGGAGACGGTGTTTGAGCTGATGACCACCCTGC
ACACCAAGCTGATAGGCTTCAATCTCCAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.0
SRP021940_embryo 0.1
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PVNCNEKIVVLLQRLKPEIKDVIEQ-LNPVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTALHTKLEGFHTQ
P.N...K.VV.LQRLKP....VIEQ....VT.WL.LQIP..EDGN.FG.AVQE.VFELMT.LHTKL.GF..Q
Retrocopy
PMN-GKKMVVVLQRLKPGTRPVIEQ/VSLVTIWLPLQIPWLEDGNSFGMAVQETVFELMTTLHTKLIGFNLQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide