RetrogeneDB ID:
retro_ecab_1004
Organism:
Horse ( Equus_caballus )
Location:
9:2446587-2447580 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
56.25 %
Coverage:
98.81 %
Frameshifts:
4
Stop codons:
3


Parental gene:
Parental gene symbol:
LDHA
Parental gene aliases:
No gene alias available
Parental gene description:
L-lactate dehydrogenase A chain [Source:RefSeq peptide;Acc:NP_001138352]

Genomic region (view in browser)





>retro_ecab_1004
AAGATGGCAACTATCCAGTGTGAACTTACTGAGAATTTCACTTCAGAGGAGACCGCTCAT
CACACTAAGATCTCCATTATGGGAACAGGATCGGTTGGCATGGCCTGTGCTGTCAGTTTC
TTATCAAAAGACTGGAGTGATGAACTTGCCTTTGTGGATGTTGATGAAGGCCAACTGGAG
GGCCAGGCAGTGGGTCTTCATCATGGCAGCCCTTTGGTGAACATGCCAAATGTTGTTTCC
AGTAAACGTTAGCTTGTCACTGCAAACTCCAACCTAGTGACCATCACAGCACGTGCATCC
CAAGAAAAGGAGAAACGTGCCTTCATATGGTCAAGCAAAATGTGTCCATCTTTAAATTAT
TGGTTTTGAATATTACCCAGTATAGTCCCTGCTGCAAACTGATAGTTGTTTCCAAGCCAG
TGGATATCTTAACTTATGTAGCTTAAAAGTTGAGTGCATTTCCCAAAAATTGTTATTGGA
AGTGGCTGTAATCTGGACACTGCCCGTTTCCATTTCTTTTTGGGCAGAAGCTTGGTATCC
ACTCTGAAAGCTGTCATGAATGGATCCTTGGAGAGTATGGAGACTCAAGTGTACCCGTGT
GGAGTGGACTTGACGTTGCTCATGTCCCTCTACAGGATCTGAACTCAGATATAGGAATTG
ATAAAGATCCTTAGCAGTGGGAAAATGTCCACGAAGGAGTGATTATCTGTGGCTATGAGA
TGTTTAAAATGAGAGGTTATACTAACTGGGCGATTGGCCTATCTGTAGCTGGTTTAATGG
AAAGCATTTCAAAGAATCTTAGGGGAGTGTGTCCGGTTTCCACCATAAGTAAGGGCCTCT
AATGGAGTAAATGAAGAAGTATTCCTTAGCATTCCTTGTATGCCAGGAGAGAATGGTATT
GCAGACCTTTTAAAGATAAAGCTGACCGCTGAAGAGGAGACCCGTTCGAAAAAGAGTACA
GAAAAACCTTGGGAAATTCAGAAGGAGCTCAAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.17
SRP021940_cerebellum 0.15
SRP021940_embryo 0.29
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.26
SRP021940_testis 0.3

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KMATVKDQLIQNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTAHSKLVIITAGAR
KMAT....L..N...EE.....KI...G.G.VGMACA.S.L.KD..DELA.VDV.E..L.G....L.HGS.....P..VS.K...VTA.S.LV.ITA.A.
Retrocopy
KMATIQCELTENFTSEETAHHTKISIMGTGSVGMACAVSFLSKDWSDELAFVDVDEGQLEGQAVGLHHGSPLVNMPNVVSSKR*LVTANSNLVTITARAS


Parental protein
QQE-GESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLVVSNPVDILTYVAWKISGF-PKNRVIGSGCNLDSARFRY-LMGERLGVHPLSCHGWILGEHGDS
Q...GE..L..V..NV.IFK....N...YSP.CKL.VVS.PVDILTYVA.K.S.F.PK..VIGSGCNLD.ARF...L.G..LG.H..SCH.WILGE.GDS
Retrocopy
QEK/GETCLHMVKQNVSIFKLLVLNITQYSPCCKLIVVSKPVDILTYVA*KLSAF\PKI-VIGSGCNLDTARFHF/LFGQKLGIHSESCHEWILGEYGDS


Parental protein
SVPVWSGVNVAGVSLKNLHPELGTDADKEHWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGL-YGIKEDVFLSVPCIL
SVPVWSG..VA.V.L..L....G.D.D...W..VH..V....YE..K..GYT.WAIGLSVA.L.ESI.KNLR.V.P.ST..KGL..G..E.VFLS.PC..
Retrocopy
SVPVWSGLDVAHVPLQDLNSDIGIDKDP*QWENVHEGVIICGYEMFKMRGYTNWAIGLSVAGLMESISKNLRGVCPVSTISKGL\NGVNEEVFLSIPCMP


Parental protein
GQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQ
G.NGI.D..K..LT.EEE.R.KKS....W.IQKEL.
Retrocopy
GENGIADLLKIKLTAEEETRSKKSTEKPWEIQKELK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide