RetrogeneDB ID:
retro_ecab_1008
Organism:
Horse ( Equus_caballus )
Location:
9:37973888-37974490 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
66.51 %
Coverage:
89.57 %
Frameshifts:
6
Stop codons:
1


Parental gene:
Parental gene symbol:
MOB2
Parental gene aliases:
No gene alias available
Parental gene description:
MOB kinase activator 2 [Source:HGNC Symbol;Acc:24904]

Genomic region (view in browser)





>retro_ecab_1008
GAAGGCCAAGCGAAGCCCAACGGGGAGAAGCCGGCCGCGGAGAAGATGTACCTAGGAGCT
GGAGTACACCAAGTCCGGAATCACCGACTTCCAGGTCAAGGGACTGCTGGTGCTGCCCGG
GGAGAATGACCTCCACGTGCGGCTGGCCAGCACATCACGACATTTTTCTGCAGGTCAACC
TGCAGCATAGCACTGCCTCAGAATTCTGCACAGGAGAGGCGTGCCAGACGATGGCCGTGT
GTGACACACGGTACTACTGGTGAGAGCTGGGGAAGAAGGTCAAGTGCACACGCCCCAGTA
TGTCGACTTTGTCTTGAGCTCAGCGCAGAACCGGGTGATCAACGAGGGCGTGTTCCACAT
GAAATAGGCAGTGAATTCTCCAGCTCCTTCGAGTCAATGGTGAAGAAGATCTGCAAATAC
CTGTTCCCGATGCTAGGGTACGTCTGCTCGTCCCACTTCCAGGAAACCCTGGCCTTGGAG
CTGCACGCGCGCTTGAATACACTCTATGGCCAGTTCCTCTTCTCCACGAAGTTCAACCTG
CTTGGTTCCAAAGAGACCCTGGTCATGACCATTGCATCGAGGTGCTGTGCAGCGGCAGGG
GT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.05
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.24

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KSKAKPNGKKPAAEEKKMYL-EPEYTKSRITDFEFKELVVLPREIDLNEWLASNT-TTFFHH-VNLQYSTISEFCTGEACQTMAVCNTQYYWHDERGKKV
...AKPNG.KPAAE..KMYL.E.EYTKS.ITDF..K.L.VLP.E.DL...LAS...TTFF...VNLQ.ST.SEFCTGEACQTMAVC.T.YYW..E.GKKV
Retrocopy
EGQAKPNGEKPAAE--KMYL\ELEYTKSGITDFQVKGLLVLPGENDLHVRLASTS/TTFFCR/VNLQHSTASEFCTGEACQTMAVCDTRYYW*-ELGKKV


Parental protein
KCT-APQYVDFVMSSVQKLVTDEDVF-PTKYGREFPSSFESLVKKICKYLFHVLAHIYSSHFKETLALELHGHLNTLYVHFILFAREFNLLDPKETAVM-
KCT..PQYVDFV.SS.Q..V..E.VF.P...G.EF.SSFES.VKKICKYLF..L....SSHF.ETLALELH..LNTLY..F.LF...FNLL..KET.VM.
Retrocopy
KCT/TPQYVDFVLSSAQNRVINEGVF/PHEIGSEFSSSFESMVKKICKYLFPMLGYVCSSHFQETLALELHARLNTLYGQF-LFSTKFNLLGSKETLVM/


Parental protein
DDLTEVLCSSGG
D...EVLCS..G
Retrocopy
DHCIEVLCSGRG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide