RetrogeneDB ID:
retro_ecab_101
Organism:
Horse ( Equus_caballus )
Location:
1:115229096-115229735 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
95.81 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
HMGB1
Parental gene aliases:
No gene alias available
Parental gene description:
High mobility group protein B1 [Source:UniProtKB/Swiss-Prot;Acc:Q08IE6]

Genomic region (view in browser)





>retro_ecab_101
ATGGGCAAAGGAGAGCCTAAGAAGCCGAGAGGCAGAATGTCATCCTATGCATTCTTTGTG
CAAACTTGCCGGGAGGAGCACAAGAAGAAGCACCCAGATGCTTCAGTCAACTTCTCAGAG
TTTTCTAAGAAGTGCTCAGAGAGGTGGAAGACCATGTCTGCTAAAGAGAAGGGAAAATTT
GAAGACATGGCAAAGGCGGACAAGGCCCGTTATGAAAGAGAAATGAAAACGTATATCCCT
CCTAAAGGGGAAACAAAAAAGAAGTTCAAGGATCCCAATGCACCTAAGAGGCCTCCTTCG
GCCTTTTTCTTGTTTTGTTCTGAGTATCGCCCAAAAATCAAAGGAGAGCATCCTGGCCTA
TCCATTGGTGATGTTGCAAAGAAACTGGGAGAAATGTGGAATAACACTGCTGCAGATGAC
AAGCAGCCTTATGAAAAGAAGGCTGCTAAGCTGAAGGAGAAATACGAAAAGGATATTGCT
GCATACCGAGCTAAAGGAAAACCTGATGCAGCGAAAAAGGGAGTCGTCAAGGCTGAAAAA
ATCAAGAAAAAGAAGGAAGCGGAGGAAGACGAGGAAGATGAAGAGGATGAGGAGGAGGAG
GAGGTGGAAGATGAAGAAGAAGATTATGATGATGAATAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 1.34
SRP021940_cerebellum 0.0
SRP021940_embryo 0.14
SRP021940_placental_villous 0.13
SRP021940_synovial_membrane 0.7
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS
MGKG.PKKPRG.MSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS
Retrocopy
MGKGEPKKPRGRMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS


Parental protein
AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE
AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK.KKKKE.EEDEEDEEDEEEE
Retrocopy
AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKIKKKKEAEEDEEDEEDEEEE


Parental protein
EDEEDEDEEEDDDDE
E.E...DEEED.DDE
Retrocopy
EVE---DEEEDYDDE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide