RetrogeneDB ID:
retro_ecab_1010
Organism:
Horse ( Equus_caballus )
Location:
9:44953503-44954443 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.25 %
Coverage:
70.05 %
Frameshifts:
5
Stop codons:
4


Parental gene:
Parental gene symbol:
BCL2L13
Parental gene aliases:
No gene alias available
Parental gene description:
BCL2-like 13 (apoptosis facilitator) [Source:HGNC Symbol;Acc:17164]

Genomic region (view in browser)





>retro_ecab_1010
ATGGCATCTTCTACTACTGTGCCTCTAGGGTTTCACTAGCATGAAAGTACAAAGTATGTT
GTTCTCAGCTACTTGGGAGTCTTCTCTCAGGAGAAGCTGCAAGAGCCACGTCTTTCCTCA
CCCCAAGGAGTTCAACAAGATGTAGCTTCACAATCTCTGATCAAGAAGTTTTATTAAAAG
TTAAAACTGAAATTGAATAAGAGCTAAAATCTCTGGACAAAGAAATTTCTGAAGCCTTCA
CTAGCACAGGCTTTGACCCAGTCACACATCTCCAGTTTTGAACCTTGCTAACCCAGAAAG
CTCAGTAGAAGATTGCTTGACTCATCTTCAAGAAAAAGTGTTGCAGGAACTGAAAGAGGC
TCCACATGAGGAGCTGCTAATGCTCCTCAGCCAACCAGTGACATATCAGGCATATCAGGA
ATGTACACTGGAGACCACATTTCATGCCAGTGGCTGGAGTAAGATTTTGGTGTCTCTGAT
TTTGCTAGACAAATGCTTTTGGAGTTGACAAGACCTCATCAAGAACCTTTGTGTGCCATG
CTGCAGTTTGATGTGATGTATCTGGAGGACTATGTAGCATAGTACATTATTCAGCAAAGT
GGCTGGGGCACTGTCTTTAATTTTGAGTCAGAGGAGGAGGAATATCCTGGAATCGTTGCA
GAAGGTAGGAATGACACTTACATCCTGCCCAGTGACAACTCTGGACAAGTCAGTCCTCCA
GAGTCTCCAACTATGACCACTTTTTGGCAATCAGAGAGCTTACCTGTTTCACTGTCAGCC
AGCAAGAGTTGGCACACAGAAAAGCCTACCAGTGTCCCTAGGTCCTGAGTCCTGGCAGCA
GATTGCAATGGATCTTAAAGAAGTCAAAAGCTTAGATAGCAATAGGGCTGGAGAGAAGAG
TGAGGATAATTCATCTAGTCCTGACATTTGCATGCTGGAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MASSTTVPLGFH--YETKYVVLSYLGLLSQEKLQEQHLSSPQGVQQDVTSQTL-DQEVLLKVKAEIEEELKSLDKEISEAFTTTGFDRHTS-PVFSPANP
MASSTTVPLGFH....TKYVVLSYLG..SQEKLQE..LSSPQGVQQDV.SQ.L.DQEVLLKVK.EIE.ELKSLDKEISEAFT.TGFD..T....F.P..P
Retrocopy
MASSTTVPLGFH*HESTKYVVLSYLGVFSQEKLQEPRLSSPQGVQQDVASQSL/DQEVLLKVKTEIE*ELKSLDKEISEAFTSTGFDPVTH\SSFEPC*P


Parental protein
-ESSVEDCLAHLGEKVSQELKEPLQKALQMLLSQPVTYQAYRECTLETTVHANGWNKILVPLILL-RQMLLELTRRGQEPLSALLQFGVTYLEDYAAEYI
.ESSVEDCL.HL.EKV.QELKE.....L.MLLSQPVTYQAY.ECTLETT.HA.GW.KILV.LILL.RQMLLELTR..QEPL.A.LQF.V.YLEDY.A.YI
Retrocopy
\ESSVEDCLTHLQEKVLQELKEAPHEELLMLLSQPVTYQAYQECTLETTFHASGWSKILVSLILL/RQMLLELTRPHQEPLCAMLQFDVMYLEDYVA*YI


Parental protein
IQQGGWGTVFNLESEEEEYPGTVAEDSNDIYILPSDNSGQVSPPESPTVTTSWQSESLPVSLSASQSWHTE-SLPVSLGPESWQQIAMDPEEVKSLDSNG
IQQ.GWGTVFN.ESEEEEYPG.VAE..ND.YILPSDNSGQVSPPESPT.TT.WQSESLPVSLSAS.SWHTE.SLPVSLGPESWQQIAMD..EVKSLDSN.
Retrocopy
IQQSGWGTVFNFESEEEEYPGIVAEGRNDTYILPSDNSGQVSPPESPTMTTFWQSESLPVSLSASKSWHTE\SLPVSLGPESWQQIAMDLKEVKSLDSNR


Parental protein
AGEKSENNSSNSDIVHVE
AGEKSE.NSS..DI...E
Retrocopy
AGEKSEDNSSSPDICMLE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide