RetrogeneDB ID:
retro_ecab_1013
Organism:
Horse ( Equus_caballus )
Location:
9:63065600-63066380 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
63.77 %
Coverage:
92.88 %
Frameshifts:
3
Stop codons:
5


Parental gene:
Parental gene symbol:
LIX1
Parental gene aliases:
No gene alias available
Parental gene description:
Lix1 homolog (chicken) [Source:HGNC Symbol;Acc:18581]

Genomic region (view in browser)





>retro_ecab_1013
AGAGACCTGGGGCTCAGTTCCAAAGACTTGAATGGTGTGTCTGTGTTAACAGGAACTTTG
GGAAAGCAAGCAGCAGCAAAGGGCTGCTTTCCCAAGTGGAGCCATGGTGGTCTACAAGTC
CACGCCATCTCTTGGGCCTCCCTCTGTGAGTGATGTGACCTTCCAGGGGGGACAGTATTT
TGGCAACTTTCAGTGCTGCTTCACTAGAGCTGAGGCATGACAGGATACAGCTAAAGTGGT
CTGGGTCAACTCCTTTTTCAATAAGCTGCCCTCTCCAAGGATCACCAAGGAATTCATCAA
AGGAAGTGTTCAGGAAGCAATTGCCTATGCCAGCAACACTCTAGACTTGCTTATGACCCC
AGCATCAGCATCAGAGCCCATCATGTTCGAGTCAAATATAGGGAAGACCATATTTGGAAT
TCCAGGAGCCAATGACCATTTTCCAACTATCGCACTGGAAGGGAAGCCTTAAAAGCCCTT
CGTGAAACAAAGTGTTCCCAACAGAAAATCTTCTCCCACTATTTCCAGTATGCCCTAGAT
GAAAAGATGCGCAGCTGTGTGGCCCTGGACTGGATTATAAAGGAGTAAGAGTTACCAGGA
ATGCTCTCTGAAGAGCAATGAGTGGTCTTGAGGGAGTTAGAGCAAGCCAGGAAAGCAGGA
TAACCATACTGCTACATAGAAAATAAAGAAATTTGGAGCTTAGCCTTGACTTAGATCCAC
AGTGGGCTTGACACTTCCTCGCCCAGTGATGATCTGCTGAGCCACACGACTCTGTGCGGC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.64
SRP021940_cerebellum 0.0
SRP021940_embryo 0.22
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 2.42
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RDPALVFKDLNVVSML-QEFWESKQE-RAAFPSEGVVIYESLPSPGPPFVSYVTLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFI
RD..L..KDLN.VS.L.QE.WESKQ..RAAFPS...V.Y.S.PS.GPP.VS.VT..GG..FGNFQCC..RAEA..D.AKV...NS.FN.LPS.RITKEFI
Retrocopy
RDLGLSSKDLNGVSVL\QELWESKQQQRAAFPSGAMVVYKSTPSLGPPSVSDVTFQGGQYFGNFQCCFTRAEA*QDTAKVVWVNSFFNKLPSPRITKEFI


Parental protein
MESVQEAVASTSGTLDDADDPSTSIGAYHYMLESNMGKTM-LEFQELMTIFQLLHWNGS-LKALRETKCSRQEVISYYSQYSLDEKMRSHMALDWIMKER
..SVQEA.A..S.TLD....P.........M.ESN.GKT..LEFQE.MTIFQL.HW.GS.LKALRETKCS.Q...S.Y.QY.LDEKMRS..ALDWI.KE.
Retrocopy
KGSVQEAIAYASNTLDLLMTPASA--SEPIMFESNIGKTI\LEFQEPMTIFQLSHWKGS\LKALRETKCSQQKIFSHYFQYALDEKMRSCVALDWIIKE*


Parental protein
ESPGILSQELRMALRELEEARKAGQELRFYKEKKEILSLALTQIYSESDTSSPSDDQLSLTALCG
E.PG.LS.E....LRELE.ARKAG.......E.KEI.SLALT.I.S..DTSSPSDD.LS.T.LCG
Retrocopy
ELPGMLSEEQ*VVLRELEQARKAG*PYCYI-ENKEIWSLALT*IHSGLDTSSPSDDLLSHTTLCG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide