RetrogeneDB ID:
retro_ecab_1017
Organism:
Horse ( Equus_caballus )
Location:
9:67670408-67671995 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
98.49 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
KPNA2
Parental gene aliases:
No gene alias available
Parental gene description:
karyopherin alpha 2 (RAG cohort 1, importin alpha 1) [Source:HGNC Symbol;Acc:6395]

Genomic region (view in browser)





>retro_ecab_1017
ATGTCCTCCAACGAGAATGCTAATTCCCCGGCTGCCCGCCTTAACAGATTCAAGAACAAG
GGGAAAGACAGCACAGAAATGAGGCGGCGCCGAATAGAAGTTAATGTGGAGCTGAGGAAA
GCTAAGAAAGATGACCAGATGCTGAAAAGGAGAAATGTAAGCTCCTTTCCTGATGATGCT
ACTTCTCCGCTACAGGAAAACTGCAACAACCAGGGCACTGTAAATTGGTCTGTTGAGGAT
ATTGTCAAAGGCGTAAACAGCAACAATTTGGAAAGCCAGCTCCAAGCTACTCAAGCTGCT
AGGAAACTGCTTTCTAGAGAAAAACAGCCCCCCATAGACAACATAATCCGGGCTGGTTTG
ATTCCAAAATTTGTGTCCTTCTTGGGCAGAACTGATTGTAGTCCCATTCAGTTTGAGTCT
ACTTGGGCCCTCACTAACATCGCTTCCGGGACATCAGAACAGACCAAGGCTGTGGTAGAG
GGAGGTGCTATCCCAGCATTCATTTCTCTGTTGGCATCTCCCCACGCCCACATCAGTGAA
CAAGCCGTATGGGCTCTAGGAAACATTGCAGGTGATGGTTCGGTTTTCCGAGACTTGGTG
ATCAAGTATGGTGCAGTTGACCCGCTGTTGGCTCTTCTTGCAGTTCCCGATATGTCATCT
TTGGCATGTGGTTACTTACGTAATCTTACCTGGACACTTTCAAACCTTTGTCGCAACAAG
AATCCTGCACCCCCATTAGATGCTGTTGAGCAAATTCTTCCCACTTTAGTTCGTCTCCTG
CATCATGATGATCCAGAAGTATTAGCAGATACCTGTTGGGCCATTTCCTACCTTACCGAT
GGTCCGAATGAACGGATTGAAATGGTCGTGAAAACAGGATTGGTACCCCAACTTGTAAAG
CTTCTAGGATCTACTGAATTGCCAATTGTGACTCCTGCACTAAGAGCCATAGGAAATATT
GTCACTGGGACAGACGAACAGACTCAGGTTGTAATAGATGCAGGAGCACTTGCCATCTTT
CCCAGCCTGCTAACGAACCCCAAAACTAACATTCAGAAGGAAGCTACGTGGACAATGTCA
AACATCACAGCTGGCCGCCAGGACCAGATACAGCAAGTTGTGAATCATGGATTAGTCCCA
TTCCTCATTGGTGTTCTCTCTAAGGCAGACTTTAAGACACAAAAGGAAGCTGTATGGGCT
GTGACCAACTATACAAGTGGTAGAACAGTTGAACAGATTGTATACCTTGTTCATTGTGGC
ATAATAGAACCGTTGATGAACCTCTTAACTGCAAAAGACACCAAAATTATTCTGGTTATT
CTGGATGCCATTTCAAATATCTTTCAGGCTGCTGAGAAACTAGGTGAAACTGAGAAACTT
AGTATAATGATTGAAGAATGTGGAGGTCTGGACAAAATTGAAGCTCTACAAAACCATGAA
AATGAGTCTGTGTACAAAGCTTTGTTAAACTTGATTGAGAAGTATTTCTCTGTAGAGGAA
GAGGAAGATGAAAATGTTGTGCCAGAAACTACCTCTGAAGGCTATACATTCCAAGTTCAG
GATGGCCCTCCGGGGACCTTTAACTTT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.65
SRP021940_embryo 2.3
SRP021940_placental_villous 0.22
SRP021940_synovial_membrane 0.21
SRP021940_testis 4.87

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSSNENANSPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVEDIVKGVNSNNLESQLQATQAA
MSSNENANSPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQEN.NNQGTVNWSVEDIVKGVNSNNLESQLQATQAA
Retrocopy
MSSNENANSPAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENCNNQGTVNWSVEDIVKGVNSNNLESQLQATQAA


Parental protein
RKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVEGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV
RKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFES.WALTNIASGTSEQTKAVVEGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV
Retrocopy
RKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESTWALTNIASGTSEQTKAVVEGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLV


Parental protein
IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIEMVVKTGVVPQLVK
IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIEMVVKTG.VPQLVK
Retrocopy
IKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIEMVVKTGLVPQLVK


Parental protein
LLGSTELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAIFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAVWA
LLGSTELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAIFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFL.GVLSKADFKTQKEAVWA
Retrocopy
LLGSTELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAIFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLIGVLSKADFKTQKEAVWA


Parental protein
VTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLNLIEKYFSVEE
VTNYTSG.TVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKA.LNLIEKYFSVEE
Retrocopy
VTNYTSGRTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKALLNLIEKYFSVEE


Parental protein
EEDQNVVPETTSEGYTFQVQDGPPGTFDF
EED.NVVPETTSEGYTFQVQDGPPGTF.F
Retrocopy
EEDENVVPETTSEGYTFQVQDGPPGTFNF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide