RetrogeneDB ID:
retro_ecab_1020
Organism:
Horse ( Equus_caballus )
Location:
9:82579033-82579443 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.12 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
RPL28
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L28 [Source:HGNC Symbol;Acc:10330]

Genomic region (view in browser)





>retro_ecab_1020
ATGTCTGTGCATCTGCAATGAATGGTCTTGCAGAACAGCTCCAGCTCCCTGATCAAGGGG
AACATGCAGACGTGCAGCACTGAACCCGACAATCTGAAGGCCCTCAACTCCTCCTGCTCC
AGTGGGCTCATTCACTGCAAGACGGCAGGTGTGGAGCCGGCGGCCAACAGCAAAGGTGTC
ATGGTGGTCATGAAGCGGAGATGTGACTAGCAAAAGCTGGCCACCTCCTACATGCAGACC
ACCATCAATAAGAATGTCCAGGACACTCTCAGCAGCATCCAGCACACGATCTGAAACAAC
AAGTACCACCCTTATCTGTGCATGGCCGCCATCCACAGAGCCAGGGCCATACTGCACAGC
CAGAAGCTGGTGATGGTGAAGAGGAAGCAGACCCTCCCACCAAGAGCTCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVVMKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRRN
MS.HLQ.MV..N.SS.LIK.N.QT.STEP.NLKA.NS....GLIH.KT.GVEPAA..KGV.VVMKRR....K.ATSY..TTINKN...TLSSI.H.I..N
Retrocopy
MSVHLQ*MVLQNSSSSLIKGNMQTCSTEPDNLKALNSSCSSGLIHCKTAGVEPAANSKGVMVVMKRRCD*QKLATSYMQTTINKNVQDTLSSIQHTI*NN


Parental protein
KYRPDLRMAAIRRASAILRSQKPVMVKRKRT-RPTKSS
KY.P.L.MAAI.RA.AIL.SQK.VMVKRK.T..PTKSS
Retrocopy
KYHPYLCMAAIHRARAILHSQKLVMVKRKQT/PPTKSS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide