RetrogeneDB ID:
retro_ecab_1022
Organism:
Horse ( Equus_caballus )
Location:
9:30136585-30137459 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.12 %
Coverage:
96.38 %
Frameshifts:
5
Stop codons:
7


Parental gene:
Parental gene symbol:
EI24
Parental gene aliases:
No gene alias available
Parental gene description:
etoposide induced 2.4 [Source:HGNC Symbol;Acc:13276]

Genomic region (view in browser)





>retro_ecab_1022
TGTGTAGTTGATATTTTGGGTGGTGAAGAGATGGCTGACAATGTGAAAACCTATCTCCAG
GACCTTGCCATGGGAATGAAAGACTCCATCTGGGGTATTTGTACTATCTCAAAACTAGAT
GCTTGAATCCAGGAGAAAGGAGAAAAGCAGCATTGAAGAAGAACAAGTAGTGCCCTGGCA
AGGTGGAGAGAGTGGGATATGGAGAAGAAGCGAGAGAATGAGCCACAAGTTATTTCTGGA
AGTTTCCAGTGCTATGCTTAGAATGGCAGAGCATTCTGATTAGGTCTCTTCTTGTTTCAT
TGAGTATTTATTACTGTGCTTCAGCCAGTAATAGCACAAGTTACCGGTGACCCATCACTA
CATGGAGATGTTTGGCTGTGGCTGGAATTCTTCCTTCCATTACATCCAGTGCTCATTGGG
TGCTCCCCAGTCTGTGTTTAGCAAAGTTGTCAATGCCTTTTGTTTTCAAGATGGAGCTGA
TCTGGCCTTTGAGGCATCAAGGAGGAAGCCTCATCCATTCCCTAGTGTCAGCGAACAATT
GTTTACATGCTCTTCAATGGTTGGCTGCAGGCTCTTTTCTTCCCCCAGGGGATGTTTTTA
AGTTTCCTTCCCATCCATCTTGTTGGTCAGCTGGTTAGTCTACTGCATATATCTCTCTCT
ACTCATTATACTGCTTCAAATATCACTAGTTCAATAAAGAAATTGAAACACACAACGGTT
GTCAAACAAAGAAAAGAATTGACCTTACTATCTTGGATTTGGTTTGCCCCTGACTTTCCT
CACAACAGTGCAGTCCTCATACATTAGCAGTGGCTGCCTCTTCTCTACCCTTTTTCCTTT
ATTCATTGTCAGCTTAATGAATGGCAAAGAGCCA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
CVVGSWGGEEMADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIFQCCAWNGGVFWFSLLLFY
CVV...GGEEMAD.VKT.LQDLA.G.KDSIWGICTISKLDA.IQ.K.E.Q..RR.SS.LA..R....E.K.E.EP...S..FQC.A.NG..F...L.LF.
Retrocopy
CVVDILGGEEMADNVKTYLQDLAMGMKDSIWGICTISKLDA*IQEKGEKQH*RRTSSALARWREWDMEKKRENEPQVISGSFQCYA*NGRAF*LGLFLFH


Parental protein
RVFIPVLQSVTAQIIGDPSLHGDVWSWLEFFL-TSIFSALWVLPLF-VLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVS-KIIADMLFNLLLQALFLIQ
.VFI.VLQ.V.AQ..GDPSLHGDVW.WLEFFL.....SA.WVLP...V.SKVVNA..FQD.ADLAFE.S.RKPHPFPSVS...I..MLFN..LQALF..Q
Retrocopy
*VFITVLQPVIAQVTGDPSLHGDVWLWLEFFL/SITSSAHWVLPSL/VFSKVVNAFCFQDGADLAFEASRRKPHPFPSVS/RTIVYMLFNGWLQALFFPQ


Parental protein
GMFVSLFPIHLVGQLVSLLHMSL-LYSLYCFEYRWFNKGIEMH-QRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTP
GMF.S..PIHLVGQLVSLLH.SL.LYSLYCF.Y..FNK.IE.H.QRLSN.E.N.PYY.GFGLPL.FLT..QSSYI.SGCLFS.LFPLFI.S....K.P
Retrocopy
GMFLSFLPIHLVGQLVSLLHISL/LYSLYCFKYH*FNKEIETH/QRLSNKEKN*PYYLGFGLPLTFLTTVQSSYISSGCLFSTLFPLFIVSLMNGKEP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide