RetrogeneDB ID:
retro_ecab_1025
Organism:
Horse ( Equus_caballus )
Location:
9:46519188-46519811 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.25 %
Coverage:
70.65 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
RPS2
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S2 [Source:HGNC Symbol;Acc:10404]

Genomic region (view in browser)





>retro_ecab_1025
CTTTTCTCCCTGCCCATCAAGGAATCTGAGAATATTGACTTTTTTTCTGGGGGCATCCCT
CTAGGATGAGGTTTTGAAGATCATGCCTATACAAAAGCAGACCCATACTGGCCAGCGGAC
AAGGTTCAAGGCATTTGTTGCCATTGGGGATTACAATGGACTTATCAGTCTGGGTGTTAA
GTGCTCTAAGGAGGTAGCCACTGCCATCTGTGGGGCCATCATACTTGCAAAGCTCTTCAT
CATCCCCATGCTGCAAGGGTACTGGGGGAACAAGATCAGTTAGCCCCTTGCAAGGTGACT
GGCCACTGTGGCTCTACTGTGGCTCTGTGCTGGTGTGCCTCATCCCTGCTTCCAGAGGCA
CTGGCATCATCTTAGCCCCTGTGGCCAAGAAGCTGCTGCTGATGGCCAGTATTGACGACT
GCTACACCCCAGCCAGGGACTGCACTGCTACCATGGGCAACTTTGCCAAGGCCAGCTTTG
ATGCCATCTCCAAGATCTACAACTATCTCACCTCCGATCTCTGGAAAGAAAACATGTTCA
TCAAGTCTTTTTACCAGAAATTCACTGACCTTCCTGTAAAGACCCACACCAAAGTCTCTG
TGTAGAGGACCCAGCTTCCAGCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.07
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.13
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LFSLPIKESEIIDFF-LGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIV-PVRRGYWGNKIGKPHTV
LFSLPIKESE.IDFF.LGASL.DEVLKIMP.QKQT..GQRTRFKAFVAIGDYNG...LGVKCSKEVATAI.GAIILAKL.I..P...G..G.....P...
Retrocopy
LFSLPIKESENIDFF\LGASL*DEVLKIMPIQKQTHTGQRTRFKAFVAIGDYNGLISLGVKCSKEVATAICGAIILAKLFII\PCCKGTGGTRSVSPLQG


Parental protein
PCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKNHTRV
.......CGSVLV.LIPA.RGTGI..APV.KKLL.MA.IDDCYT.AR.CTAT.GNFAKA.FDAISK.Y.YLT.DLWKE..F.KS.YQ.FTD..VK.HT.V
Retrocopy
DWPLWLYCGSVLVCLIPASRGTGIILAPVAKKLLLMASIDDCYTPARDCTATMGNFAKASFDAISKIYNYLTSDLWKENMFIKSFYQKFTDLPVKTHTKV


Parental protein
SVQRTQAPA
SV.RTQ.PA
Retrocopy
SV*RTQLPA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide