RetrogeneDB ID:
retro_ecab_1038
Organism:
Horse ( Equus_caballus )
Location:
Un0019:744318-745283 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
95.67 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
ASB1
Parental gene aliases:
No gene alias available
Parental gene description:
ankyrin repeat and SOCS box containing 1 [Source:HGNC Symbol;Acc:16011]

Genomic region (view in browser)





>retro_ecab_1038
AGTGCAGGTCCTAATCTGAAGGAGTGGCTGAGGGAGCAGTTTTGTGACCATCCGCTAGAG
CACTGCGAGGACACCAGGCTCCATGATGCAGCCTGCGTGGGGGACCTCCAGACCCTCAGG
AGCCTGTTACAAGAGGAGGGCTACCGGAGCCGCATCAACGAGAAATCTGTCTGGTGCTGT
GGCTGGCTGCCCTGCACACCACTGCGAATCGCGGCCACTGCTGGCCGTGGGAACTGTGTG
GACTTCCTGATCCAGAAGGGGGCCGAGGTGGATCTGGTGGATGTAAAGGGACAAGACTGC
CCTGTATGTGGCTGTGGTGAACGGGCACCTGGAGAGTGCCCAGATCCTCCTTGAAGCCGG
CGCCGACCCCAACGGAAGCCGGCACCATCGCAGTACGCCTGTCTACCACGCCTCTCGTGT
GGGCAGGGCCGACATACTGAAGGCTCTCATCAGGTATGGGGCTGATGTCGATGTCAACCA
CCACCTGACTCCAGACATCCGGCCCCCTTTTTCCCCGGCGCCTCAGCTCCTTGGTCGTCT
GCCCCTTGTACATCAGCGCGGCCTACCACAACCTCCAGTGCTTCAAGCTGCTCCTCCAGG
CTAGGGCGAACCCCGACTTCAACTGCAACGGCCCTGTCAACACGCAGGGCTTCTACAGGG
GCTCCCCCGGGTGCGTCATGGATGCAGTCCTGCGTCATGGCTGTGAGGCGGCCTTTGTGA
GCCTGCTCGTAGCGTGTGGAGCGAACCTGAACCTGGTGAAGTGGGAATCCTTGGGCCCAG
AGTCGAGAGGCAGAAGGAAGGCCGACCCCGAGGCATTGCACGTCTTTAAAGAGGCCAGAA
GTGTCCCCAGGACCTTGCTGAATCTGTGCAGTCTGGCCGTGAGAAGAGCTCTTGGCAAAT
ACTGACTCCATCTGATTTCTTCGCTGCCTCTGCCAGACCCCATAAAGAAGTTTCTACTTT
ATGAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.2
SRP021940_embryo 0.24
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SAGPNLKEWLREQFCDHPLEHCEDTRLHDAAYVGDLQTLRSLLQEEGYRSRINEKSVWCCGWLPCTPLRIAATAGHGNCVDFLIQKGAEVDLVDVKGQ-T
SAGPNLKEWLREQFCDHPLEHCEDTRLHDAA.VGDLQTLRSLLQEEGYRSRINEKSVWCCGWLPCTPLRIAATAG.GNCVDFLIQKGAEVDLVDVKGQ.T
Retrocopy
SAGPNLKEWLREQFCDHPLEHCEDTRLHDAACVGDLQTLRSLLQEEGYRSRINEKSVWCCGWLPCTPLRIAATAGRGNCVDFLIQKGAEVDLVDVKGQ\T


Parental protein
ALYVAVVNGHLESAQILLEAGADPNGSRHHRSTPVYHASRVGRADILKALIRYGADVDVNHHLTPDIRPPFS-RRLTSLVVCPLYISAAYHNLQCFKLLL
ALYVAVVNGHLESAQILLEAGADPNGSRHHRSTPVYHASRVGRADILKALIRYGADVDVNHHLTPDIRPPFS.RRL.SLVVCPLYISAAYHNLQCFKLLL
Retrocopy
ALYVAVVNGHLESAQILLEAGADPNGSRHHRSTPVYHASRVGRADILKALIRYGADVDVNHHLTPDIRPPFS\RRLSSLVVCPLYISAAYHNLQCFKLLL


Parental protein
QAGANPDFNCNGPVNTQGFYRGSPGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPESRGRRKVDPEALQVFKEARSVPRTLLNLCRVAVRRALG
QA.ANPDFNCNGPVNTQGFYRGSPGCVMDAVLRHGCEAAFVSLLV..GANLNLVKWESLGPESRGRRK.DPEAL.VFKEARSVPRTLLNLC..AVRRALG
Retrocopy
QARANPDFNCNGPVNTQGFYRGSPGCVMDAVLRHGCEAAFVSLLVACGANLNLVKWESLGPESRGRRKADPEALHVFKEARSVPRTLLNLCSLAVRRALG


Parental protein
KYRLHLIPSLPLPDPIKKFLLYE
KY.LHLI.SLPLPDPIKKFLLYE
Retrocopy
KY*LHLISSLPLPDPIKKFLLYE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide