RetrogeneDB ID:
retro_ecab_1041
Organism:
Horse ( Equus_caballus )
Location:
Un0076:114329-115230 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.82 %
Coverage:
67.04 %
Frameshifts:
5
Stop codons:
3


Parental gene:
Parental gene symbol:
TUBA1C
Parental gene aliases:
No gene alias available
Parental gene description:
tubulin, alpha 1c [Source:HGNC Symbol;Acc:20768]

Genomic region (view in browser)





>retro_ecab_1041
ATGCATGAACGCACGTTCATTCACCTTGGCCAGGCCAGTGTCCAGATTGGCAATGCCTGC
TTGAAGTTCTATTGCCTGAAAAATGGCATCCAGCCCAATGGCCAGATGCTAAGTGACAAG
ATCATTGGGGCAGGAGATGACTCCTTCAACAGCTTCCTCAGTGGGACAGCTGCTGGCAAG
CATGTGTGCAGGGTCATGTTTGTAGACCTGAAATCCACAGTCATTGATGAAGTTCACACT
GGAACTTACCACCAGCTCTTCCACCCTGAGCAGCTCATCACAGGCAAGGAAGATGCTAAC
AATAACTATGCCTTCAGGTACAACCATTGGTAAGATCATTGCCCTCCTCATGTACTGAAT
TCATAAGCTGAGAACCAATGCAGAAGTTTTCAGGGCCTCTAGGTTTTCCACAGCTTTGCA
GGGCAACTGGTTCTTAGTCCACCTCCCTACAGGTGGCACTTTTCTCTGTAGGTGATGCCA
AGATGTCCAAACTGCAGTTCTCCATTTACCCAGCACCCCCAGGTTTCCACAGCTGTTGTT
GAAGCCCACGACTCCATTCTCACCACCCATACCACCCTGGAGCACTCCGATTGTGCCTCT
GTTGTAGAAAATGAGGCCATCTATGACCTCTATTATAGAAACCTCAATATTGAGCACCCA
ACCTACACTAACCTTAACCACCTTATTAGTCAGACTGTGTCCTCCATCACTAACTGCTTA
TTTCAGATTTGATGGAGCCCTGAATATTCATCTGACAGAATTCCAGGCCATCCTGATGCC
CTATTCCTGCATCCACCTCCCTCTGGTCACATATGCCCTTGTCATCTCTTCTAAGAAAGC
TTACCATGAACATCTTACTGTAGCAGAGATCAACAAGGTATACTTTGAGCCAGTCAACAA
G

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.07
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAA
M.E...IH.GQA.VQIGNAC...YCL..GIQP.GQM.SDK.IG.GDDSFN.F.S.T.AGKHV.R..FVDL..TVIDEV.TGTY.QLFHPEQLITGKEDA.
Retrocopy
MHERTFIHLGQASVQIGNACLKFYCLKNGIQPNGQMLSDKIIGAGDDSFNSFLSGTAAGKHVCRVMFVDLKSTVIDEVHTGTYHQLFHPEQLITGKEDA-


Parental protein
NNYARGHY-TIGKEIIDLVLDRIRKLA-DQCTGLQGFLVFHSFGG-GTGSGFTSLLMERLSVDYGKKSKLEFSIYPAP-QVSTAVVEPYNSILTTHTTLE
NN.....Y.TIGK.II.L....I.KL...QC...QG..VFHSF.G..TGS..TSL.....SV...K.SKL.FSIYPAP.QVSTAVVE...SILTTHTTLE
Retrocopy
NNNYAFRY\TIGK-IIALLMY*IHKLR/NQCRSFQGL*VFHSFAG/ATGS*STSLQVALFSVGDAKMSKLQFSIYPAP\QVSTAVVEAHDSILTTHTTLE


Parental protein
HSDCAFMVDNEAIYDICRRNLDIERPTYTN-LNRLISQIVS-SITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNA
HSDCA..V.NEAIYD...RNL.IE.PTYTN.L..L.......S.TA..RFDGALN..LTEFQ..L.PY..IH.PL.TYA.VIS..KAYHE.LTVAEI...
Retrocopy
HSDCASVVENEAIYDLYYRNLNIEHPTYTN\LTTLLVRLCPPSLTAYFRFDGALNIHLTEFQAILMPYSCIHLPLVTYALVISSKKAYHEHLTVAEINKV


Parental protein
CFDPTNQ
.F.P.N.
Retrocopy
YFEPVNK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide