RetrogeneDB ID:
retro_ecab_1042
Organism:
Horse ( Equus_caballus )
Location:
Un0076:71893-75229 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.53 %
Coverage:
88.25 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
HDLBP
Parental gene aliases:
No gene alias available
Parental gene description:
high density lipoprotein binding protein [Source:HGNC Symbol;Acc:4857]

Genomic region (view in browser)





>retro_ecab_1042
TCCAAAGAAAATTTGACTGAGCACCAAAGTAGGTCCATTCAAAAAGGCAATTATGTTACT
GCTTTAAATTCAGAAGAACATATTGGCACTCCAACCTACAAAGGTAAATTCAGTCAACTC
TTAGAGAAAAGAAATTGGTTGGAAAATGCTCAGGAACCTGCTGAATGCTTGAGTAACAAT
AGTCAGCCTAGCACAACCTCAGTCATCACTCAAGTCTTTCATGTGCCTCTAGAGGAGAAC
GAGTATGTGAATCAGTTTGGTAAAGATAGACAAGGAAAATTCTACCTAGATATCATGCAA
AAGACTGGTGCCAATGTAGAATTAATTTTTGTCAAAGACCAGGGCCTCTACATTATAGTC
TCTGGTGAAACAGAAACTGTCATGAAAGCTCAGAAGGAGATTTTTACATGGTTTCAGGAT
CGAGGTTTAACTGCAGTGTCCATTCCCGAAGAACAGCCGTGCTTTGTTACAGGCAAGACT
GGAGGAGAAATGCAAGACTTAGAAGAAAAAGATGCAACCTACATCCAGAACTTATGCCCA
GATAACCACAGCAACTGGATTAATACTGTGGGCATCAAAGAGGTCATGAAGAAGGATTTA
CATGAAGTCCTAGGTATGTCTACTGATCAAGACAAATGTGCTGTAGAGAAGTTAGATGAG
AAAAAAGCATTTTTTCCTTCCACTCCTGGACCATCCAGTAAAACTTTTGACAAAATTATA
CCAGAAACAGAGGCACACATCCATGTTCCACCACCTAGTGTCGATCAGACACAAGTAGGC
TTTACTGAAAAAAAGCAGCAGCTTAATGAGGCTCAGGCTTGTGTAAAGGAGATTTTTGAC
AGCACTAAAAAGAAAAACACACCCATCAATGCAGAGATGAAATTTCAGCACAAGTGTACC
ATAGGTCCCAAGAGAAATTCTGTGCAGGAGACCTTGCCAAGAAGTGGAATTTCAATAGAG
ATCTTACCCGTAGAGAGCATGTCAGCTTCTGTGACAGAGCAAGGTGAGCCTGGAAGCTCA
GGGAAGGCATTTTCCAAAGCCAGTTCGAAGACCGAACGTTACACTGTTTCCTCGATCTTT
GTACCTTCCTGGCTTCACAGATTTATTATTGGTAAGAAAGGTTGTAATATATCTGAAATC
ACACACAGCATGCCAAAAGTTCACATAGAATTTACTGAAGGAGATAAAATTACAATAAAA
GGACCAAAAGAAGATGTGAATGATGCTCAAGAACAAATTGAGGTCATAGTCAAAGATCTA
ATTAACAGGATGGATTATGCAGAAATCAATGTTGACTGTAAGTTTCACAAACATCTGATA
GGGAAGAATGATGCCATCATAAAGCAAATTAAAGAGAGGAATAATGTTTCTGTGCTAATG
TCACCTAAAAATGTAAAGAATAAATTGATTAGAATTGAGGGGGAATCTCAGGGAGTCCAA
CAAGCCAAGAGAGAACTTCTTGAACTTGCTGGTCATTTAGAAAATGAGCACAGCAAGGAT
TTAATCATTGAGCAAAGATTTCACCCTGCAATCATTGGGTGGAAAGGTGAACGGATCCAT
GACATCCAGAAGAAATTCCCAGAGGTGATGATTCATTTTCCTGACCAAGCACAAAAAAGT
GACACAGTCCAACTTAGAGGGCCAAAACATGAAATAGAAAAATGCACACAATATTTGGAG
AATGTGGTGGCAGACATTGTAGAGAGTAGCTATTCCGTAACTATTCCCAACTTTAAAAAG
CCTCACAGAAATGTCAATGGAGAAGGAGGTGCAAACATAAAAAAAATCTGTGCAGCAAGC
AACACCAAAAGTAATCCTCCGTCGGCAAGTGGCTACTCAGAAGATATTGTCATCAGTGGA
AAACCTGCAAACTGTGAAGTAGCTTCTAACTGGATTCTTCCAACTCAGAAACATATAACC
AATAGTTCAGAGGTAGAAATTTCTATTCCTTCCAATCTATACAAGTCTCTTACCGATTCT
AAAGACTGTTTGATTGGTGCAATCATGCAAGAATGTGGAAGGATCCACATCCACTTTCCA
AAAATGGACTCAGGCCTTCAAAGAGTCATTATTAGGGGCCCTGCCCAAAGTGTTGAAAAG
GCCAAGACAAAACTGCTACAACTAGCAGAAGAAGAGCAAACCAAGAGTCATACTGTAATT
CTCCACGTCAAACCACAGTATCACAAATTCCTCATGAATAAAAATGGTGGCAATGTTTCC
AAAGTCTGTAATGAGACTGGAGCGCACATCATTTTCCCTATCCCTGAGGACAAGGATCAA
GAATTGTTAACTATTAAAGGAACAGAGAAGGCTGTCAAAGATGCACAAAAGGGACTAGCG
GCACTAATTACAAATCTAGATAACATTGTAGAGGAGGACATACTGATAAATCCTGTTTAC
CACCATCATTTTTTCATGAGAAGAGGCCCGGTTTTTCGCGAGATAACTGAGGAGTATGGT
GGTGTTAGTATTAACTTTTCATATTCAGGAAAACAGAGAAGCAAAGTCACAATCAAAGGA
GCAAAGCCTTGTGTGGAAGCCGCCAAAAAGCACATTCAGGAGATTACTGGGGACTTGGAT
AGTCAAGTCACAACAGAATGTATTATTCCCCAGAAGTTCCATCATTTTATCATGGGACAA
ATGTGTTCTCGAATCCAACAAATTACTAGAGATTATAATGTCCAAATCAAATTCCCAGAT
AAAGAGAACTCAGTTACTAATATGGATCCAACCATTCAGAAAAATGAGGAAGAAGTTAGG
GAAAAGAGCACTACGGAAGCTGCTTCTATTTCCCCAAGGAAATGTGACACCATACTTATC
TCTGGCCAAAAGGAAGAGTGTGCAGCAGCCATGGAAGCCCTTGAGGCTTTAATTCCTGTC
ACTGCTGAACTAGACGTGCCCTTTGACCTACACCATTATATCATTGGTCAGAAAAGAAGA
GAGATACGAAAGATAATGGATAGGTTTGAAGTTAATATACACATGTCAACACCTGGATTG
GCATCTGATATCCTTTTTATCACGGGCCTTGCTGCAAATGTGGAGCAAGCCAAAGCTAGG
TTACAAGAACTTGTCAAGGCTTTACAAAACGAAGCAAAAGATCGAGCATTAAGAAATTTT
AAACTCAAGTTCACAGTAGACCCCAAATATCACCCTAAGATCATTGGTCACAAAGGGGTA
GTTATTACTCAGATTTGCTTGAAGCATAAGGTTGCTATTCATTTTCCACGTAAAGGAAGT
GATGAGACACAAGACCAAATCACCATCACTGGATATGAAAATAACACCATCGCTGCCCAG
AATGCAATCATGAAACTGGTGCATAAATTTGAAAAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.0
SRP021940_testis 5.76

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEKAACLENAQEPAGAWSNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKICLEI
..E...EH.S........V..LNSEE....PTYK..F..L.EK...LENAQEPA...SN...P...SVITQVFHVPLEE..Y...NQFG...Q.K..L.I
Retrocopy
SKENLTEHQSRSIQKGNYVTALNSEEHIGTPTYKGKFSQLLEKRNWLENAQEPAECLSNNSQPSTTSVITQVFHVPLEENEY--VNQFGKDRQGKFYLDI


Parental protein
MQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDASNQIRITGTKEGIEK
MQ.TGA..EL...KDQGL.I.VSG....VMKA.K.I....Q......V.IP.E...FV.GK.G...QDLE.K.AT.IQ...PD..SN.I...G.KE...K
Retrocopy
MQKTGANVELIFVKDQGLYIIVSGETETVMKAQKEIFTWFQDRGLTAVSIPEEQPCFVTGKTGGEMQDLEEKDATYIQNLCPDNHSNWINTVGIKEVMKK


Parental protein
ARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAVEVKKSQH
..HEVL..S..QDK.AVE.L...KAF.P...GP.......I..ET...I..PPPSV..T...FT..K.QL..A.A..K.I....KKK.T.I..E.K..QH
Retrocopy
DLHEVLGMSTDQDKCAVEKLDEKKAFFPSTPGPSSKTFDKIIPETEAHIHVPPPSVDQTQVGFTEKKQQLNEAQACVKEIFDSTKKKNTPINAEMK-FQH


Parental protein
KYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDR
K..IGPK.NS.QE.L.R.G.S.EI.P..S.S..V...GEP...G.A......K....TVSS...PSWLHRFIIGKKG.N...IT..MPKVHIEFTEG.D.
Retrocopy
KCTIGPKRNSVQETLPRSGISIEILPVESMSASVTEQGEPGSSGKAFSKASSKTERYTVSSIFVPSWLHRFIIGKKGCNISEITHSMPKVHIEFTEG-DK


Parental protein
ITLEGPTEDVNVAQEQIEAMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELASRMENE
IT..GP.EDVN.AQEQIE..VKDLINRMDY.EIN.D.KFH.HLIGK..A.I..IK....VSV...P...K..LIRIEG..QGVQQAKRELLELA...ENE
Retrocopy
ITIKGPKEDVNDAQEQIEVIVKDLINRMDYAEINVDCKFHKHLIGKNDAIIKQIKERNNVSVLMSPKNVKNKLIRIEGESQGVQQAKRELLELAGHLENE


Parental protein
RTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKI
..KDLIIEQRFH..IIG.KGERI..I..KFPEV.I.FPD.AQKSD.VQLRGPK.E.EKCT.Y....VAD.VE.SYS...P.FK..H.N..G.GGANIKKI
Retrocopy
HSKDLIIEQRFHPAIIGWKGERIHDIQKKFPEVMIHFPDQAQKSDTVQLRGPKHEIEKCTQYLENVVADIVESSYSVTIPNFKKPHRNVNGEGGANIKKI


Parental protein
REESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSS
...SNTK...P.....SE.I.I.GK.ANCE.A...IL..QK...N..EVE.SIP..L..SL...K..LI..IM.ECG..HIHFP...SG...V.IRGP..
Retrocopy
CAASNTKSNPPSASGYSEDIVISGKPANCEVASNWILPTQKHITNSSEVEISIPSNLYKSLTDSKDCLIGAIMQECGRIHIHFPKMDSGLQRVIIRGPAQ


Parental protein
DVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDNTGARIIFPAAEDKDQELITIIGKEDAVREAQKELEALIQNLDNVVEDSMLV
.VEKAK..LL.LAEE.QTKS.TV....KP.YHKFL..K.GG...KV...TGA.IIFP..EDKDQEL.TI.G.E.AV..AQK.L.ALI.NLDN.VE...L.
Retrocopy
SVEKAKTKLLQLAEEEQTKSHTVILHVKPQYHKFLMNKNGGNVSKVCNETGAHIIFPIPEDKDQELLTIKGTEKAVKDAQKGLAALITNLDNIVEEDILI


Parental protein
DPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTIECAIPQKFHRSVMGPKGSRIQQITRDYNVQI
.P..H.HF..RRG.V.REI.EEYGGV...F..SG.Q..KVT.KGAK.CVEAAKK.IQEI..DL..QVT.EC.IPQKFH...MG...SRIQQITRDYNVQI
Retrocopy
NPVYHHHFFMRRGPVFREITEEYGGVSINFSYSGKQRSKVTIKGAKPCVEAAKKHIQEITGDLDSQVTTECIIPQKFHHFIMGQMCSRIQQITRDYNVQI


Parental protein
KFPDREENPVHSVEPAVQENGDDAGEGRDAKEADPGSPRRCDIITISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYIIGQRGSGIRKMMDEFEVNIH
KFPD..EN.V....P..Q.N.....E.....EA...SPR.CD.I.ISG.KE.C.AA.EALEAL.PVT.E..VPFDLH.YIIGQ....IRK.MD.FEVNIH
Retrocopy
KFPDK-ENSVTNMDPTIQKNEEEVRE-KSTTEAASISPRKCDTILISGQKEECAAAMEALEALIPVTAELDVPFDLHHYIIGQKRREIRKIMDRFEVNIH


Parental protein
VPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYE
...P.L.SDI..ITGLAAN...AKA.L.E.VK.LQ.E..DRALR.FKL..TVDPKYHPKIIG.KG.VITQI.L.H.V.I.FP.K......QDQITITGYE
Retrocopy
MSTPGLASDILFITGLAANVEQAKARLQELVKALQNEAKDRALRNFKLKFTVDPKYHPKIIGHKGVVITQICLKHKVAIHFPRK-GSDETQDQITITGYE


Parental protein
KNTEAARDAILKIVGELEQ
.NT.AA..AI.K.V...E.
Retrocopy
NNTIAAQNAIMKLVHKFEK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide