RetrogeneDB ID:
retro_ecab_1043
Organism:
Horse ( Equus_caballus )
Location:
Un0077:24067-24941 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
85.95 %
Coverage:
53.9 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
LCORL
Parental gene aliases:
No gene alias available
Parental gene description:
ligand dependent nuclear receptor corepressor-like [Source:HGNC Symbol;Acc:30776]

Genomic region (view in browser)





>retro_ecab_1043
TTGAAGGATTGTCTACCATCTCTTGATTCTTCACAGTCAACACCAACAGAGAAACTGTCA
TCTCAGGGCCAGTCCAACACTGAAAGACTGAATGCCAAGCAGAAAATTAGCTAAATGCAC
TCTTTCGAAAGAAAGACCTTCCTCAGAACTGTGATCCTAACATTCCCCTAGTTGCTCAGG
AATTAATGAAAAAGATGATACGTCAGTTTGCAATTGAGTATATTTCAAAAAGTGGTAAAA
TTCAAGAGAATAGAAATGGTTCAATTGGACCAAGTCTAATATGTAAAAGTATTCAAATGA
ATCAAGCAGAAAACTCCCTTCAGGAAGAACAGGAAGGCCCCTTAGACCTCACTGTGAATC
GAATGCAAGAACAAAATACTCAGCAAGGGGATGGAGTGTTAGATCTCTCTACAAAGAAAA
CCAGCATAAAATCTGAAGAGTCGTCCGTATGCGATCCTTCTTCTGAAATTCAATGGCTGG
GAGACTACAGAGAAACAGAGAGGACTATGTGGAGAGAAGTGCTGAGTTTGCAGATGGTTT
GCTCTCAAAAGCTTTGAAAGACATTCAGTCTGGAGCACTGGACAGAAATAAAGCAGGCAT
ACCTCAAAAAACTTTACTTCTCCACTTAGAAGCCTTACCAGCAGGGAAGCCTGCATCTTT
TAAAAACAAAGCTCGAGATTTCAGTGATAGTTACTCATATAAAGACAGTAAAGAAACTTG
TGCAGTGCTGCATAAAGTAGCCCTGTGGGCAAGAGCTCAAGCAGAGCGCACAGAAAAAAG
TAAACTCAATCTAATTTAAAGAAAAAAATGAAAGCCTACAATATGAAACTTCACGTCCTA
CTGTACAGTTAAAAATTCCTCAACTACGAGTAAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.81
SRP021940_cerebellum 1.1
SRP021940_embryo 4.02
SRP021940_placental_villous 0.89
SRP021940_synovial_membrane 1.64
SRP021940_testis 0.18

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VSDCLPSLDSSQSTPTEELSSQGQSNTEKI-ECQAESYLNALFRKKDLPQNCDPNIPLVAQELMKKMIRQFAIEYISKSGKIQENRNGSIGPSLICKSIQ
..DCLPSLDSSQSTPTE.LSSQGQSNTE...ECQAE..LNALFRKKDLPQNCDPNIPLVAQELMKKMIRQFAIEYISKSGKIQENRNGSIGPSLICKSIQ
Retrocopy
LKDCLPSLDSSQSTPTEKLSSQGQSNTERL/ECQAEN*LNALFRKKDLPQNCDPNIPLVAQELMKKMIRQFAIEYISKSGKIQENRNGSIGPSLICKSIQ


Parental protein
MNQAENSLQEEQEGPLDLTVNRMQEQNTQQGDGVLDLSTKKTSIKSEESSICDPSSE-NSVAGRLHRNREDYVERSAEFADGLLSKALKDIQSGALDINK
MNQAENSLQEEQEGPLDLTVNRMQEQNTQQGDGVLDLSTKKTSIKSEESS.CDPSSE.NS.AGRL.RNREDYVERSAEFADGLLSKALKDIQSGALD.NK
Retrocopy
MNQAENSLQEEQEGPLDLTVNRMQEQNTQQGDGVLDLSTKKTSIKSEESSVCDPSSE/NSMAGRLQRNREDYVERSAEFADGLLSKALKDIQSGALDRNK


Parental protein
AGILYGIPQKTLLLHLEALPAGKPASFKNKTRDFNDSYSYKDSKETCAVLQKVALWARAQAERTEKSKLNLLETSELKFPTASSYLHQLTLQKMVTQFK
AGI....PQKTLLLHLEALPAGKPASFKNK.RDF.DSYSYKDSKETCAVL.KVALWARAQAERTEKSKLNL......K.PT........T.....T..K
Retrocopy
AGI----PQKTLLLHLEALPAGKPASFKNKARDFSDSYSYKDSKETCAVLHKVALWARAQAERTEKSKLNLI*RKK*K-PTI*NFTSYCTVKNSSTTSK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide