RetrogeneDB ID:
retro_ecab_1045
Organism:
Horse ( Equus_caballus )
Location:
Un0202:19652-20093 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
56.95 %
Coverage:
73.37 %
Frameshifts:
4
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_1045
AGAGGGAAAAGAGAGGGCTTATCCAAAGAAATAAAAGCTGAGAAATTCCCAAACCTGGGG
GAAGTTCCAGATTTAAAATTACAGGAAGCCAATATAATACCTAATTACATCAATGTTAAA
AGACCTTCTTTGAGGCACATAATAGTAAAAATGGCAAAAGCCAAGGACAAAAAAAAAAAA
AGATAAAGTTAGCAAAGCAGAAGAAAATAATCTACAAAGGAACCCTCTCATGCTTTTAGC
AGCTTTCTCAGCAGAAACTAAAGGCTAGGAGAGAATGGAATGATATATTCAAAATACTGA
AAGACAAAAACAAACTTACAGCCAAGAATACTCTTTCCAGTGAAACTTTCCTTCAGATGC
AAAGTAGAAATAAAAAGTTTCCCAAATAAACAAAAGCTGAGGGAGTTCATCACCACTAGA
CCTTACTTACAAGAAATATTA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QNRRESLFKEIITENFLNLGKGLEIQVKEANRTPNYINVERPSPRHILV-KLAKLVMKEYIMAEAARQKKITYKGS-PIRLSADFS-QTVQTRREWNDII
...RE.L.KEI..E.F.NLG........EAN..PNYINV.RPS.RHI.V.K..K...........A.QKKI.YKG..P..L.A.FS.Q....RREWNDI.
Retrocopy
RGKREGLSKEIKAEKFPNLGEVPDLKLQEANIIPNYINVKRPSLRHIIV/KNGKSQGQKKKKIKLAKQKKIIYKGT/PLMLLAAFS\QKLKARREWNDIF


Parental protein
KIL-KYK-NYPPRILYPVKLSFRYGREIKAFQDKQKLREFITTRPPLQEMM
KIL.K.K.N..PRIL.PVKLSFR...EIK.F..KQKLREFITTRP.LQE..
Retrocopy
KIL\KTKTNLQPRILFPVKLSFRCKVEIKSFPNKQKLREFITTRPYLQEIL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide