RetrogeneDB ID:
retro_ecab_1055
Organism:
Horse ( Equus_caballus )
Location:
X:24200046-24200784 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
74.31 %
Coverage:
98.81 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
TRPT1
Parental gene aliases:
No gene alias available
Parental gene description:
tRNA phosphotransferase 1 [Source:HGNC Symbol;Acc:20316]

Genomic region (view in browser)





>retro_ecab_1055
ATGAACTCCTCTGGCGGAAGGAGGCAGGAAGCAGCAGGGCCTGGGGGCAGAAGTACTCAC
AGATCCCAAGAATCAGATGTGCAACTGTCCAAGGCTCTGCCCTGCGCCCTGTGCCACGGG
GCCCTGAAGCTGAGGTTTCCCACGGGGGCCAACAGCTTTGTGCCCCTGGGCGCCCTCCTG
CAGCTCCCCAGTTCCGAAGCATCTCAGCTAAAGGTGTGCACTGTGTGGTGGACACCAAAG
GGAAGCAGCGCTTTGCCCTGCAGCTGGGGGACTCCAGCACTGGCCTTCTCATCCAGGCCA
ATCAGGGACACTCTCTGTAGGTACCTTAGTTGGAGTTGATGCCCCTGGGGACCCCACAGG
CCCTGCCCTGATGCTCATCCATGGCACATTCTGGCAGCACTGGCCATCCATCTTGCTCAA
GGGCCTGTCCTGCTGGGGAAGGATGCACATCCACCTGGCCCTAGGACTGCCTGGGGATCC
TGGTGTCAGTGGCATGTGGTCAAACTGCAGACGGGTCATGTTCATCAACAGGCCCCTGGC
CCTGGCAGATGGAGCCCTTTTCTTCAGCTCTGCCAATGAAGTGATTCTGACTCCAGGGAA
AGCTGATGGCTTCCTGCTTCCCAAGTACTTCAAGGAGGCCCTGCAGCTATGCCCTACCGA
AACCCTCTCTCCTTGGCTGATAATGAAAAGACAGAGTGTCAGAGTGGCCCTGAGCACAGC
TCCAGAGGAAGAAGGATA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MDTSGGRRQEAGGPRGRKARRPREQDRDMQLSKALSYALRHGALKLGLPMGADGFVPLGALLQLP-QFRSFSAEDVQRVVATNAKQRFALQPGDPSTGPL
M..SGGRRQEA.GP.GR...R...Q..D.QLSKAL..AL.HGALKL..P.GA..FVPLGALLQLP.QFRS.SA..V..VV.T..KQRFALQ.GD.STG.L
Retrocopy
MNSSGGRRQEAAGPGGRSTHR--SQESDVQLSKALPCALCHGALKLRFPTGANSFVPLGALLQLP/QFRSISAKGVHCVVDTKGKQRFALQLGDSSTGLL


Parental protein
IRANQGHSLQVPELELMPLETPQALP-PMLIHGTFWQHWPSILLKGLSCRGRTHIHLATGLPGDPGVISGIRPNCEVAVFINGPLALADGIPFFRSANGV
I.ANQGHSL.VP.LELMPL.TPQALP..MLIHGTFWQHWPSILLKGLSC.GR.HIHLA.GLPGDPGV.SG...NC....FIN.PLALADG..FF.SAN.V
Retrocopy
IQANQGHSL*VP*LELMPLGTPQALP/LMLIHGTFWQHWPSILLKGLSCWGRMHIHLALGLPGDPGV-SGMWSNCRRVMFINRPLALADGALFFSSANEV


Parental protein
ILTPGDADGFLFPKYFKEALQLRPT-RKPLSLAGDEETECQSGPKHSSRGRRM
ILTPG.ADGFL.PKYFKEALQL.PT.R.PLSLA..E.TECQSGP.HSSRGRR.
Retrocopy
ILTPGKADGFLLPKYFKEALQLCPT/RNPLSLADNEKTECQSGPEHSSRGRRI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide