RetrogeneDB ID:
retro_ecab_1056
Organism:
Horse ( Equus_caballus )
Location:
X:26558806-26559987 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.85 %
Coverage:
100.0 %
Frameshifts:
7
Stop codons:
5


Parental gene:
Parental gene symbol:
LAMP1
Parental gene aliases:
No gene alias available
Parental gene description:
lysosomal-associated membrane protein 1 [Source:HGNC Symbol;Acc:6499]

Genomic region (view in browser)





>retro_ecab_1056
TTGCTCCTGCTGCTGCTTGCAGGACTGATGCATAGTAAATCTGCAGTGTTTATGGAGAAA
AGTGGCTACTGATCAGCTTGCCCAATGGACAACTTCTCAAGCTGCCTTCTTGAGGAACTA
TCATACAAAAGTGGTGCTAAAAATGTGACCTTGAATCCACCATCAAATGCAGAAATACTG
AGTAGTAGCTGTGGTGGCAAAGAGAATGCTTCTGATGCCAATACAGTGATTGCTTTTGAA
GAAAAATATACGTTGACCCTCAATTTCATAAGAAATACAGCATCATACAGTATCCAACTG
TTAGGTTTTGCTTATAACTTGTCAGACATAACTATTTCTCTCAATGCAAGGGCAAAAGGA
AACAAGATTATGGAATCCATACCTGACATCAAGTACACATAGATAAAAAATACACACGTG
TCAGAGACAACCAGATACACATGAATAATGTAACTATTAAACTATATGAAGTAACTATCC
AGGAATATCTTTCAAATAACTTCAACAAGGAAGAAATAGTGTGTAAGCAAGAAGAGCCTT
TCTCAACGACACCTCCAAGGTCAAAGCCCACCACTTCCCCAGAAATGTCCATCTGCTTAG
AAGCACAATATGCGTGGCACAAATGCAACTGGTCTGCTTGTAGCATGGGCTGATGACTGA
TCACCACTTACGAGAAAAGCTCTAAGGTGACTGTGACAAGAGCATTCAATATCAATCCAA
ATAAGACAGTGAGCTATAATTCTCATTTAGTATCACTAGAACTCTGCAGTGAAAATGTCA
CTCTTATCTTCAGTTTTGAAATGAATGCAAATTCTAGCCTGCTTTCCTACAGGGAATCCA
GTTAAATACAACTTTACATGACAGCAGAGATCCCACTATTAAAGCTTCTAATGAATCACT
GAGAGCCTTTCAAGCCACCACTGGAAATTCTCATAAGCGTAATCCTGAGGAAAACGTTCA
AGTCACAAATACGTCTTCAGTCAACATATTCAAAGTTTGGATGGGTCCAGGCTTTCAAGT
TCGAAAGTGACAAGTTTGGATCTGTGGAAGAATGTCAATCAGATGAAAATAACATGCTGA
GTTCTGTTGCCATTGGTGGTGCTCTTTCAGGAATTGTCCTCATTGTCTAAATTGCTTATC
TCGTTGCCAGGAACAGAAGTCATGCCGGGAATCAGAAAATT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LSFLELAGLMHGASAVFVVKDGNGTACIMANFS-AAFLTNYDTN-SGFKNVTFDLPSDAVVLNSSSCGKDNASGPSLVVAFGRGHTLTLTFARNATRYRV
L..L.LAGLMH..SAVF..K.G...AC.M.NFS.AAFL.NY.T..SG.KNVT...PS.A..L.SS..GK.NAS....V.AF....TLTL.F.RN...Y..
Retrocopy
LLLLLLAGLMHSKSAVFMEKSGY*SACPMDNFS\AAFLRNYHTK/SGAKNVTLNPPSNAEILSSSCGGKENASDANTVIAFEEKYTLTLNFIRNTASYSI


Parental protein
QLMRFVYNLSDAQIFPNASSKEVKTVESVTDIK-ADINKTYRCVSSDQIHMSNVTVTLHDATIQAYLSSNSFSKEETRCEQDRPSPTPTPPVTPHPSPSP
QL..F.YNLSD..I..NA..K..K..ES..DIK...I.K.Y..V...QIHM.NVT..L...TIQ.YLS.N.F.KEE..C.Q..P..T.TP...P...P..
Retrocopy
QLLGFAYNLSDITISLNARAKGNKIMESIPDIK/VHIDKKYTRVRDNQIHMNNVTIKLYEVTIQEYLSNN-FNKEEIVCKQEEPFST-TP---PRSKPTT


Parental protein
TPE-SPSVNKYNVSGTNGTCLL-ATMGLQLNVTYENRDNMTVTRVFNINPNKTRVNGSCTAQLVTLELRDEDVTLLVFHFGMNATSSQF-FLQEIQLDMT
.PE..PS..K.N..GTN.T.LL...MG..L..TYE.....TVTR.FNINPNKT....S....LV.LEL..E.VT.L.F.F.MNA.SS...FLQ.IQL..T
Retrocopy
SPE\CPSA*KHNMRGTNATGLL/CSMG**LITTYEKSSKVTVTRAFNINPNKT---VSYNSHLVSLELCSENVT-LIFSFEMNANSSLL/FLQGIQLNTT


Parental protein
LPDARDPTFKAANSSLRALQATIGNSYRCNAEERLRVTEALSVNVFRVWV-QAFQV-EGDKFGSVEECQLDENNMMIPIAVGGALAGLVLIVLIAYLIGR
L.D.RDPT.KA.N.SLRA.QAT.GNS...N.EE...VT...SVN.F.VW....FQV.E.DKFGSVEECQ.DENNM....A.GGAL.G.VLIV.IAYL..R
Retrocopy
LHDSRDPTIKASNESLRAFQATTGNSHKRNPEENVQVTNTSSVNIFKVWMGPGFQV\ESDKFGSVEECQSDENNMLSSVAIGGALSGIVLIV*IAYLVAR


Parental protein
KRSHAGYQTI
.RSHAG.Q.I
Retrocopy
NRSHAGNQKI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide