RetrogeneDB ID:
retro_ecab_1057
Organism:
Horse ( Equus_caballus )
Location:
X:35951530-35953408 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
69.26 %
Coverage:
84.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_1057
GCCAGTCCTCTTCTAGAAGAAATGGCTTCTCTAGAGGATGCCTACAGCTTTGAGGCTAAT
TCCAAACATAGTTCCCATAACTCCATGAACTCTGAATTTGCTGCCAAAGATGAGGATCAA
AATTATAAGACTGAGGAACAAAACAAGGTCCAGAGAAGGATGGATAAACAGCGAGACCAG
TGCTCTTCAGTGATCTGCATGAAGGCTATGCATGGCATCCTGGAAGAATTGATGCCACAA
GGAAGGGAAGAGGTTGCCGCTAGTGCAAAACTGAGCACAAGTGAGTGTCCCAATCCTGGA
GAAAGACCAGCCAGGCTTGTCACCTTCTCTGCTCGTCAGAAAAAGAAAGCATCAGCTCCC
GAGTTCAGAGCAGAGAAGGAAAAGATAGTGATAGAGATCAACAGCAGCGGTGACAGGAGA
GTGATTCTCGTTCCTCAGGAGAAACCCAGTGAGAAGCCAATTGGTGCCAGAAGGACAGTC
GCTTTTGAAAAAGGCTCTCTAGCCCTAGAATTTCTAGACAAACGTGACTTTCCTTTACAA
ATCCAACAGCATAGCGGAAGGGATGTGGTGGTTGAGCACCTGTCTTCAGGAAGTGACTGG
CCTGATGTGGATGAGATTTCCACAGTCACATTCTCTCAGGAGGAGCTAGTCTCACTGAGT
CTCTCAAGAGATCCAAAGTCTTCACTCTTCACCACTGTAGGTGACACATACCAGCCTCGT
TTGTACACTGGTCCTTGCTATGACTATGCCAGCTACTGGACCAGCACTCTCAAGCCTTTT
CACTATCCCTCCTTGGGCCGCAGCAGCAGCATGTCCCAGGCTGGGATGAGCACCGGGAGC
TTCTTTAGTGATTATGCCTCCAGCTCTACAGTGCACTCCCAAAACTGCTCCAGAGACCTC
ACGGCGGCAGAGAAAGGTCAGTCCCAGAATTCTCATTCATTTCATCTCTCCAGAAGTTCG
GAAGCAAAGGTGAAGGAGAAAAAAACATTCCAAGAGGAGACACCATCACGTCCTTGGGGA
GGACATGCATCTGCTTCCCTGCCGAGGAGCCAGCAGGAGCGAAGCTTACAGGAGGGTTTC
ATTGATACCCACTGTCACTTGGACATGCTCTTTTCCAAGTTATCTTTCAAAGGGACCTTT
AGGAAGTTCAGAAAAATTTATAGCCACTCCTTCCCTAAGGAATTTCAGGGCTGCATCTCT
GATTTCTGTGATCCTCGCACACTAAGCAATGGCCTATGGGAGGAGCTGTTGAAAGATGAT
CTGGTTTGGGGGGGCTTTGGCTGTCACCCCCATTTTGCATGTTACTACAATGACATTCAA
GAAAGAAATCTGTTGCAAGCCTTACGGCACCCCAAGGCTGTAGTGTTTGGAAAAATGGGC
TTGGATTACTCTCACAAGTGCACCATGCCTATCCCACAGCAGCACAAGGTATTTGAGAGG
CAGCTGAAGCTGGCTGTGTCTCTGAAGAAGCCCTTGGTGATCCACTGCCGGAACGCTGAC
GAAGATCTGCTGAGCATCATGAAGGCATTTGTGCCCTCTGACTACAAGATCCATAGGCAT
TGCTTCACTGGCAGCTACCCAGTCATCGAGCCACTTTTGAAATACTTTCCCAACATGTCT
GTGGGCTTCACAGCAGTCGTGACTTACTCTTCCGCCTGGGAGGTCCGCAATGCTCTGAAA
AAGATCCCGCTGGAGAGAATCATCGTGGAAACTGACGCTCCCTACTTCCTCCCTCGTGGG
GTTCCTAAAAGAGTTTGCCAGTATGCCCACCCAGGCCTGGCCCTGTATACAGTTCGAGAG
ATTGCCAGCATCAAAGAAGAGTCACTCTCACACACCTTGGCCACCCTGCGTGAGAACACT
AGTCGCCTCTACAGTCTT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.05
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.36

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ANPSLEEMASLEEGACSLKVDSKDSSRNSMNSEFAAEAEGQNEVTEEPNKVQKRKRDRLRDQGSTVIYLKAIQGILGKSMPKRKGEAATRAKPGPGERPS
A.P.LEEMASLE..A.S....SK.SS.NSMNSEFAA..E.QN..TEE.NKVQ.R..D..RDQ.S.VI..KA..GIL...MP....E.A..AK....E.P.
Retrocopy
ASPLLEEMASLED-AYSFEANSKHSSHNSMNSEFAAKDEDQNYKTEEQNKVQRRM-DKQRDQCSSVICMKAMHGILEELMPQGREEVAASAKLSTSECPN


Parental protein
CGEGPARSVSVSAPQKERESAPDVRAEEEKPVLEGSSFRDRRVVIDPQENPTEEPLGDRRTV-IDKRSPPLEFLDDSDSHLESQKPKEREVVLEHTSSGS
.GE.PAR.V..SA.QK...SAP..RAE.EK.V.E..S..DRRV...PQE.P.E.P.G.RRTV...K.S..LEFLD..D..L..Q....R.VV.EH.SSGS
Retrocopy
PGERPARLVTFSARQKKKASAPEFRAEKEKIVIEINSSGDRRVILVPQEKPSEKPIGARRTVAFEKGSLALEFLDKRDFPLQIQQHSGRDVVVEHLSSGS


Parental protein
DWSDVDEIPTVRFSQEEPVSLKLPAVPEPSAFPTDYVMYPAHLYSSPWCDYASYWTSSPKPSSYPSVGSGSGNDTSQAGRGSRGLLSDYPPNSTVSSHNA
DW.DVDEI.TV.FSQEE.VSL.L...P..S.F.T....Y...LY..P..DYASYWTS..KP..YPS.G..S....SQAG.......SDY...STV.S.N.
Retrocopy
DWPDVDEISTVTFSQEELVSLSLSRDPKSSLFTTVGDTYQPRLYTGPCYDYASYWTSTLKPFHYPSLGRSSS--MSQAGMSTGSFFSDYASSSTVHSQNC


Parental protein
SRDLVATEEGRSQNSRSSRFSRSSEEEELKERRTFQEETPLRPCGGHGSSSLPRSHREPSPEEGFIDTHCHLDMLYSKLSFKGTFTKFRKIYSSSFPKEF
SRDL.A.E.G.SQNS.S...SRSSE....KE..TFQEETP.RP.GGH.S.SLPRS..E.S..EGFIDTHCHLDML.SKLSFKGTF.KFRKIYS.SFPKEF
Retrocopy
SRDLTAAEKGQSQNSHSFHLSRSSEAK-VKEKKTFQEETPSRPWGGHASASLPRSQQERSLQEGFIDTHCHLDMLFSKLSFKGTFRKFRKIYSHSFPKEF


Parental protein
QGCISDFCDPRTLTDCLWEELLKEDLVWGAFGCHPHFARYYSDVQERNLLQALRHPKAVAFGEMGLDYSHKCTTPVPEQHKVFERQLQLAVSLKKPLVIH
QGCISDFCDPRTL...LWEELLK.DLVWG.FGCHPHFA.YY.D.QERNLLQALRHPKAV.FG.MGLDYSHKCT.P.P.QHKVFERQL.LAVSLKKPLVIH
Retrocopy
QGCISDFCDPRTLSNGLWEELLKDDLVWGGFGCHPHFACYYNDIQERNLLQALRHPKAVVFGKMGLDYSHKCTMPIPQQHKVFERQLKLAVSLKKPLVIH


Parental protein
CREADEDLLSIMKKFVPSDYKIHRHCFTGSYPVIEPLLEHFPNMSVGFTAVLTYSSAWEAREALKQIPLERIIVETDAPYFLPRQVPRSVCQYAHPGLAL
CR.ADEDLLSIMK.FVPSDYKIHRHCFTGSYPVIEPLL..FPNMSVGFTAV.TYSSAWE.R.ALK.IPLERIIVETDAPYFLPR.VP..VCQYAHPGLAL
Retrocopy
CRNADEDLLSIMKAFVPSDYKIHRHCFTGSYPVIEPLLKYFPNMSVGFTAVVTYSSAWEVRNALKKIPLERIIVETDAPYFLPRGVPKRVCQYAHPGLAL


Parental protein
HTVREIARVKDQPLSHTLATLRENTSRLYNL
.TVREIA..K...LSHTLATLRENTSRLY.L
Retrocopy
YTVREIASIKEESLSHTLATLRENTSRLYSL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide