RetrogeneDB ID:
retro_ecab_1058
Organism:
Horse ( Equus_caballus )
Location:
X:36840426-36841076 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.56 %
Coverage:
99.54 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
GSTM4
Parental gene aliases:
No gene alias available
Parental gene description:
glutathione S-transferase mu 4 [Source:HGNC Symbol;Acc:4636]

Genomic region (view in browser)





>retro_ecab_1058
GCCGTAATCTTGGGTTACTGGGACATCCATGGGCTGGCTCATATAGTGCACCCGTTTCTG
GAATACACAGACTCAAACTATGAGGAAAAGAACTACATGATGAGGGATACTCCTGCCTAT
GACAGAAGCCAGTGGCTAAAAGAAAAATTCAAGCTGGGCCTGGACTTTCCCAATCTTCCT
TACTTAATTCATGAGGCTCACAAGATCACCTAGAGCAATGCCATCCTTCACTACATTGCT
TGAAGCACAACCTACAAGGGGGGACAGAAGAAGGAAAGACTCATGTAGACATTTTGGAGA
ACTAGGTTACACACATCCCCAGTCAGCTGGCCAGTGTCTCCTACAGCCCTGATTTCGAGA
CACTGAAGCCTGAGTGCTTGGATGGGCTCCCTGAAAATATGAAGCTCTTTTCACAGTTTC
TGGGGAAAAGGTCATGGTTTGCATGGGACAAGATCACCTTTGTGGATTTCCTCACTTATG
ACATCCTTGACCTGCACCGTATATTTGAGCCTGAGTGCCTGAATGCATTTCCAAATGTGA
GAGACTTCATCACCTGATTAGAGGGCCTAAAGAAGTTATCTGCCTACGTTAAGTGCAGCC
GCCTCTTCCCTCGATCTGTGTACATAATGATTGCCATGTGGGGTAACAAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AMTLGYWDIRGLAHAIRLLLEYTDSNYEEKKYTMGDAPDYDRSQWLSEKFKLGLDFPNLPYLIDGAHKITQSNATL-YIA-RKHNLCGETEEEKIRVDIL
A..LGYWDI.GLAH.....LEYTDSNYEEK.Y.M.D.P.YDRSQWL.EKFKLGLDFPNLPYLI..AHKIT.SNA.L.YIA..KHNL.G.TEE.K..VDIL
Retrocopy
AVILGYWDIHGLAHIVHPFLEYTDSNYEEKNYMMRDTPAYDRSQWLKEKFKLGLDFPNLPYLIHEAHKIT*SNAILHYIA/LKHNLQGGTEEGKTHVDIL


Parental protein
ENQLMDTCNQLARVCYSPDFEKLKPEYLEALPETMKLFSQFLGKRPWFAGDKLTYVDFLAYDILDLHRIFEPKCLDAFSNLKDFITRLEGLKKISAYMKS
EN.......QLA.V.YSPDFE.LKPE.L..LPE.MKLFSQFLGKR.WFA.DK.T.VDFL.YDILDLHRIFEP.CL.AF.N..DFIT.LEGLKK.SAY.K.
Retrocopy
EN*VTHIPSQLASVSYSPDFETLKPECLDGLPENMKLFSQFLGKRSWFAWDKITFVDFLTYDILDLHRIFEPECLNAFPNVRDFIT*LEGLKKLSAYVKC


Parental protein
SRFLPSPIYTKIAIWGNK
SR..P...Y..IA.WGNK
Retrocopy
SRLFPRSVYIMIAMWGNK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide