RetrogeneDB ID:
retro_ecab_1059
Organism:
Horse ( Equus_caballus )
Location:
X:39057709-39058487 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.21 %
Coverage:
82.91 %
Frameshifts:
2
Stop codons:
6


Parental gene:
Parental gene symbol:
RDH12
Parental gene aliases:
No gene alias available
Parental gene description:
retinol dehydrogenase 12 (all-trans/9-cis/11-cis) [Source:HGNC Symbol;Acc:19977]

Genomic region (view in browser)





>retro_ecab_1059
ACAAGGAGACAGCCAGGGTGCAGAGGAGTATGCATTGCCTGCTGAGATGTACTGAAGTGG
GAGTCTGCTGCCAGTGAAATCCAAGCTGATACAAAGAACTCTCAGGTGATGGTGCTGAAA
CTGGACCTGTCCGATACCAAATCCATCCAAGTCTTTGCTGAAGGCTTTGTGGCAGAGGAA
AAGCAGCTCCGTATTCTGATCAACAATGCAAGAGTGATGATGTGTCCATATTCCAAGACA
ACCAATGGCTTTGAAACCCACCTGGAAGTCAACCACCTGGGCCACTTCCTTCTCACCCAC
TTGCTCCTGGAGTGGCTGAAGGAGTCTGCTCCTGCCGGGTGGTGGACCTGTCATCGGTGG
CCCACCATGCTGGCAAGATTCGTTTCTACAACCTCTAGAGTGAGAACTGCTACAGCTGGA
GTTTTGCTTACTTCCACAGCAAGCTGGCCAATGCGCTTTTTACTCAGGAGCTGGCCAAGA
AGCTCCAAGGCACAGGGGTCACCACCTACGCAGTGCACCCAGGCATCATCCACTCTGAGC
TGGTCTGACACTTCTTCCTGCGTGCCTGCTATGGTGGCTCTTCTTCCCCTTCGTCAAGTC
GGCCTAGGAGGGGGCACAGACCAGCTTGCACTGCACCCTGGCTGAGGGCCTGGAGTCCCT
GAGTGGCGAGCACTTCAGTGACTGCGAGAGGACCTGAGTGTCTCCAAAGGCCTGAAATAA
CAAAATAGCTGAGTGCCTGCAGATCGCCAGCTGTGAGCTTCTAGGAATCCAGGGAGAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TARELARRGARVYIACRDVLKGESAASEIRADTKNSQVLVRKLDLSDTRSIRAFAEGFLAEEKQLHILINNAGVMMFSHSKTTDGFEINLGVNHLGHFLL
T.R....RG..V.IAC.DVLK.ESAASEI.ADTKNSQV.V.KLDLSDT.SI..FAEGF.AEEKQL.ILINNA.VMM...SKTT.GFE..L.VNHLGHFLL
Retrocopy
TRRQPGCRG--VCIAC*DVLKWESAASEIQADTKNSQVMVLKLDLSDTKSIQVFAEGFVAEEKQLRILINNARVMMCPYSKTTNGFETHLEVNHLGHFLL


Parental protein
TYLLLERLKESAPA-RVVNLSSVIHHLGKIHFHNFRGEEPYRWGFAYCHSKLANLLFTRELAKRIQGTGVTTYAVHPGIVRSELARHSFL-CCLFWRLFS
T.LLLE.LKESAPA.RVV.LSSV.HH.GKI.F.N...E..Y.W.FAY.HSKLAN.LFT.ELAK..QGTGVTTYAVHPGI..SEL..H.FL..CL.W.LF.
Retrocopy
THLLLEWLKESAPA/RVVDLSSVAHHAGKIRFYNL*SENCYSWSFAYFHSKLANALFTQELAKKLQGTGVTTYAVHPGIIHSELV*HFFL/ACLLWWLFF


Parental protein
YFLKSVQEGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARDNKTAQRLWNVSCELLGIQWE
.F.KS..EGAQTSLHC.LAEGLE.LSG..FSDC.RT.VSP.A..NK.A..L...SCELLGIQ.E
Retrocopy
PFVKSA*EGAQTSLHCTLAEGLESLSGEHFSDCERT*VSPKA*NNKIAECLQIASCELLGIQGE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide