RetrogeneDB ID:
retro_ecab_106
Organism:
Horse ( Equus_caballus )
Location:
1:183874748-183875276 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.36 %
Coverage:
95.58 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
ARF1
Parental gene aliases:
No gene alias available
Parental gene description:
ADP-ribosylation factor 1 [Source:HGNC Symbol;Acc:652]

Genomic region (view in browser)





>retro_ecab_106
ATGAGGAAGGTGCTGTTCAGTTTCTTTGGGAACAAGGAGCTGCGGATCCTCATGCTGGGC
CTGGACGCGGCCGGCAAGACCACCATCCTGTACAAGCTGAAGCTCGGCCAGTCGGTGACC
ACCATCCCCACGGTGGGCTTCAACGTGGAGACGGTGACTTACAAAAACGTCAAGTTCAAC
GTGTGGGACGTGGGCGGCCAGGACAAGATCCGGCCGCTCTGGCGGCACTACTACACCGGG
ACCCAGGGCCTGATCTTCGTGGTGGACTGCGCCGACCGCGACCGCATCGACGAGGCCCGC
CAGGAGCTGCACCGCATCATCAACGACCGGGAGATGCGGGACGCCATCATCCTCATCTTC
GCCAACAAGCAGGACCTGCCCGATGCCATGAAGCCCCACGAGATCCAGGAGAAACTGGGC
CTGACCCGGATTCGGGACAGGAACTGGTATGTGCAGCCCTCGTGTGCCACCTCGGGGGAC
GGACTCTATGAGGGGCTCACATGGTTAACCTCTAACTACAAATCCTAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 40.3
SRP021940_cerebellum 18.67
SRP021940_embryo 31.07
SRP021940_placental_villous 55.27
SRP021940_synovial_membrane 60.17
SRP021940_testis 26.64

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREE
K...S.FG.KE.RILM.GLDAAGKTTILYKLKLG..VTTIPT.GFNVETV.YKN..F.VWDVGGQDKIRPLWRHY...TQGLIFVVD..DR.R..EAR.E
Retrocopy
KVLFSFFGNKELRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQE


Parental protein
LTRMLAEDELRDAVLLVFVNKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSGDGLYEGLDWLSNQLKN
L.R.....E.RDA..L.F.NKQDLP.AM...EI..KLGL...R.RNWY.Q..CATSGDGLYEGL.WL....K.
Retrocopy
LHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide