RetrogeneDB ID:
retro_ecab_1061
Organism:
Horse ( Equus_caballus )
Location:
X:41972115-41973614 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
86.28 %
Coverage:
99.6 %
Frameshifts:
4
Stop codons:
3


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_1061
CCACCTAGGCCGTGCTGGCCCCCAGCCAGCAGCCCGAGGTCTTCTACAACCAGATCTTCA
TAAACAAGGAGTGGCATGACGCCATCAGCAAGAAAACATTCCCTACCGTCAATCCGTCCA
CTGGGGAGGTCATCTGTTGGGTAGCTACAGGTGACAAGGAAGATGTGGACAGGGCAGTGA
AGGCTGCCCGGGCCACCTTTCAGCTTGGCTTGCCCTGGCACTGCATGGATGCGTCCAACA
GGGGTCGGCTGCTAAACCACCTGGCCGATCTGATTGAGTGGGACCAGACCTACCTGGCAG
CCTTGGAGACCCTGGATAATGGCAAGCCGTACGTTATCTCTTACCTGGTGGATTTGGACA
TGGTCCTCAAATGTCTCCGTTATTATGCCAGCTGGGCCGAGTAGTACCATGGGAAAACCA
TTCTCATCGATGGGGACTTCTTCAGCTACACCCTGCATGAACCTGTGGGGGTGTGCAGGC
AGATCATTCCATGGAACTTCCCTCTCTTCATGCAAGCATGGAAACTGGGCCCAGGCCTTG
GCAACTGGAAACGTGGTTGTAATGAAGGTGGCTGAGCAGACTCCACTCACTGCCCTCTAT
GTGGCCAACTTGATTAAGGAGGCTGGCTTTCCCCCTGGTGTGGTCAATATTGTTCTTGGA
TTTGGCCCCATGGGTGGGGCTACCATTGCCTCCCATGAGGATGTGGACAAAGTGACTTTC
ACAGGCTCCACTGAGGTTAGCCACCTAATCTAGGTTGCTGTGGGGAGAGGTAACCTCAAG
AAAGTCACCCTGGAGCTTGGAGGGAAAAGCCCCAATATCCATAATGTCAGATGCTGATAT
GGACTGGGTGGTGGAGCAGACCCACTTTGCCCTGTTCTTCAGCCAGGGCCAGTGCTGCTG
TGGGGGCTCCCGGACCTTTGTGCAGGAGGATGTTTACACTGAGTTTGTGGAGCACAGCGT
TGCCCAGGCCCGGTCTCGGTCTGGTGTGGTCAGGAACCCCTTTGACAGCCAGACCAAGCA
GGGGCCACAGGTGGATGAAACTCAGTTTAAGAAGGTCCTGGGCAATATCAAATCTGGGAA
GGAAGAGGGGGGCGAAGCTGCTGTGTGGTGGAGGGACAGCTGCTGACCATGGCTACTTCA
TCCAGCCCACCGTGTTTGGAGATGTGCAAGATGGCATGATAGTCGCAAAGGAGCAGATCT
TTGGGCCAGTGATGCAGATCCTGAAGTTGAAGACCATAGAGGAAGTCGTTGGGAGAGCCA
ACAATTCCAAGTATAAGCTGGCCGTAGCTGTCTTCATGAAGGACTTGGACAAGGCCAAGT
ATCTGTCCCAAGCCCTCTAGGCTGGCACTGTGTGGATCAACTGCTATGACGTGTTTAGGG
CCCAGTCACTATTTGGTAGCTACAAGATGTCTGGGAATGGCCAGGAGCTGGGAGAGTATG
GCCTGCAGGCATATACCAAAGTGAGAACTGTCACAATCAGAGTTCCTCAGAAGAACTCA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.23
SRP021940_cerebellum 0.5
SRP021940_embryo 0.98
SRP021940_placental_villous 0.27
SRP021940_synovial_membrane 0.26
SRP021940_testis 0.18

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PPRAC-RLPNQQPEVFYNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAAGDKEDVDRAVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDRTYL
PPR.C...P.QQPEVFYNQIFIN.EWHDA.SKKTFPTVNPSTGEVIC.VA.GDKEDVDRAVKAARA.FQLG.PW..MDAS.RGRLLN.LADLIE.D.TYL
Retrocopy
PPRPC/LAPSQQPEVFYNQIFINKEWHDAISKKTFPTVNPSTGEVICWVATGDKEDVDRAVKAARATFQLGLPWHCMDASNRGRLLNHLADLIEWDQTYL


Parental protein
AALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGP-ALATGNVVVMKVAEQTPLTA
AALETLDNGKPYVISYLVDLDMVLKCLRYYA.WA..YHGKTI.IDGDFFSYT.HEPVGVC.QIIPWNFPL.MQAWKLGP.ALATGNVVVMKVAEQTPLTA
Retrocopy
AALETLDNGKPYVISYLVDLDMVLKCLRYYASWAE*YHGKTILIDGDFFSYTLHEPVGVCRQIIPWNFPLFMQAWKLGP\ALATGNVVVMKVAEQTPLTA


Parental protein
LYVANLTKEAGFPPGVVNVVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGRSNLKKVTLELGGKSPNI-IMSDADMDWAVEQAHFALFFNQGQ
LYVANL.KEAGFPPGVVN.V.GFGP..GA.IASHEDVDKV.FTGSTEV.HLI.VA.GR.NLKKVTLELGGKSPNI.IMSDADMDW.VEQ.HFALFF.QGQ
Retrocopy
LYVANLIKEAGFPPGVVNIVLGFGPMGGATIASHEDVDKVTFTGSTEVSHLI*VAVGRGNLKKVTLELGGKSPNI\IMSDADMDWVVEQTHFALFFSQGQ


Parental protein
CCCAGSRTFVQEDVYAEFVERSVARARSR--VVGNPFDSQTEQGPQVDETQFNKVLGYIKSGKEE-GAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAK
CCC.GSRTFVQEDVY.EFVE.SVA.ARSR..VV.NPFDSQT.QGPQVDETQF.KVLG.IKSGKEE.GAKLLCGGG.AAD.GYFIQPTVFGDVQDGM..AK
Retrocopy
CCCGGSRTFVQEDVYTEFVEHSVAQARSRSGVVRNPFDSQTKQGPQVDETQFKKVLGNIKSGKEE\GAKLLCGGGTAADHGYFIQPTVFGDVQDGMIVAK


Parental protein
EEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGAQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTIKVPQ
E.IFGPVMQILK.KTIEEVVGRANNSKY.LA.AVF.KDLDKA.YLSQAL.AGTVWINCYDVF.AQS.FG.YKMSGNG.ELGEYGLQAYT.V.TVTI.VPQ
Retrocopy
EQIFGPVMQILKLKTIEEVVGRANNSKYKLAVAVFMKDLDKAKYLSQAL*AGTVWINCYDVFRAQSLFGSYKMSGNGQELGEYGLQAYTKVRTVTIRVPQ


Parental protein
KNS
KNS
Retrocopy
KNS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide