RetrogeneDB ID:
retro_ecab_1064
Organism:
Horse ( Equus_caballus )
Location:
X:43779034-43780567 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.81 %
Coverage:
73.91 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
ZXDC
Parental gene aliases:
No gene alias available
Parental gene description:
ZXD family zinc finger C [Source:HGNC Symbol;Acc:28160]

Genomic region (view in browser)





>retro_ecab_1064
GGCCCGGGCGTAGTGCTGTACCTGTGTCCCGAGGCGCAGTGCGGACAAACCTTCGCCAAG
AAGCACCAGCTGAAGGTGCACCTGCTGACGCACAGCAGCAACCAGGGCCAACGGCCCTTC
AAGTGCCCCCTGGGCGGCTGCGGCTGGACCTTCACCACCTCGTACAAGCTCAAGAGGCAT
CTGCAATCACACGACAAACTGCGGCCCTTCGGGTGTCCGGCGGAGGGCTGTGGCAAGAGC
TTCACCACCGTGTATAACCTCAAGGCACACATGAAGGGCCATGAGCAGGAGAACTCTTTC
AAATGCGAAGTGTGCGAGGAGAGCTTCCCCACGCAGGCCAAGCTCAGCGCCCACCAGCGG
AGCCACTTTGAGCCGGAGAGGCCCTACCAGTGCGCGTTTTCTGGCTGCAAGAAGACATTT
ATCACCGTGAGTGCTCTGTTTTCCCATAACCGCGCCCACTTCAGGGAGCAGGAACTCTTT
TCCTGCTCCTTTCCTGGCTGCAGCAAACAGTACGACAAGGCTTGTCGGCTGAAAATTCAC
CTGCGGAGCCACACTGGTGAGAGACCTTTCCTTTGTGACTTTGACGGCTGTGGCTGGAAC
TTCACTAGCATGTCCAAACTGTTAAGGCACAAAAGGAAGCACGACGATGACCGGAGGTTC
ACGTGCCCTGTGGAAGGCTGTGGGAAATCTTTCACAAGGGCTGAGCATCTGAAAGGCCAC
AGCATAACCCACCTGGGAACAAAGCCCTTTGTGTGCCCCGTGGAAGGCTGCTGTGCCAGG
TTCTCTGCTCGAAGTAGCCTCTACATTCACTCCAAGAAACACTTGCAAGATGTGGACACT
TGGAAAAGCCGTTGCCCAGTCTCCACTTGCAATAAACTCTTCACCTCCAAGCACAGCATG
AAGACCCACATGGCCAAAAGGCACAACCTCGGCCAGGATCTCTTAGCTCAGTTAGAAGCG
GCAAATTCTCTTACGCCCAGCAGTGAACTTGCCAGCCAGGGACAGAGTGATCTCAGTGAT
GCAGAGCTAGTGTCTCTCTTCTCTGACGTGCCTGGCAGTAGTTCTGCTGCAGTGCTAGAC
ACGGCATTGGTAAACTCTGGAATCTTGACTATTGATGTGGCTTCGGTGAGCTCAACTCTG
GCAGGGAACCTTCCTGCTGCTAATAATAGTTCCTTAGGGCAGGCTCTGGACCCTCGGGGC
TTGATGGCCACCGGTGACCTTCCTCAAAGTCTGGATACCTCTCTCTTTTTTGGAACGACA
GCCGCCGGTTTTCAGCAGAGCCCCTTAGGTATGGATGATGTCTCAAGTCTAAGCGCGGGG
CCATTGGGATCTCTGGGATCTTTGGCTATGAAAAACTCAAGTCAAGAGCCCCAAGCTTTG
ACCCCCAGCAGTAAGCTAACAGTAGACTCAGATGCTCTGACTCCTTCAAGCACCCTTTGT
GAAAACAGTGTCTCAGATCTACTGACACCAACCAAAGCAGAATGGAACATACATCCTGAC
TCTGACTTCTTTGGACAGGAGGAAGAAACCCAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 1.57
SRP021940_cerebellum 2.89
SRP021940_embryo 15.98
SRP021940_placental_villous 8.05
SRP021940_synovial_membrane 9.45
SRP021940_testis 4.69

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GPAAPRFMSPATQSALSFASKHQLKVHLVTHGGSQG-RPFKCPLDGCGWAFTSSYKLKRHLQSHDKLRPFGCPVGGCGKKFTTVYNLKAHMKGHEQESLF
GP.......P..Q....FA.KHQLKVHL.TH...QG.RPFKCPL.GCGW.FT.SYKLKRHLQSHDKLRPFGCP..GCGK.FTTVYNLKAHMKGHEQE..F
Retrocopy
GPGVVLYLCPEAQCGQTFAKKHQLKVHLLTHSSNQGQRPFKCPLGGCGWTFTTSYKLKRHLQSHDKLRPFGCPAEGCGKSFTTVYNLKAHMKGHEQENSF


Parental protein
KCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPGCEKTFITVSALFSHNRAHFREQELFSCSFPGCSKQYDKACRLKIHLRSHTGERPFICDSDSCGWT
KCEVC.E.FPT.AKLS.HQRSHFEPERPY.C.F.GC.KTFITVSALFSHNRAHFREQELFSCSFPGCSKQYDKACRLKIHLRSHTGERPF.CD.D.CGW.
Retrocopy
KCEVCEESFPTQAKLSAHQRSHFEPERPYQCAFSGCKKTFITVSALFSHNRAHFREQELFSCSFPGCSKQYDKACRLKIHLRSHTGERPFLCDFDGCGWN


Parental protein
FTSMSKLLRHKRKHDDDRRFTCSVEGCGKSFTRAEHLKGHSITHLGTKPFECPVEGCCARFSARSSLYIHSKKHLQDVGAPKSRCPVSSCNRLFTSKHSM
FTSMSKLLRHKRKHDDDRRFTC.VEGCGKSFTRAEHLKGHSITHLGTKPF.CPVEGCCARFSARSSLYIHSKKHLQDV...KSRCPVS.CN.LFTSKHSM
Retrocopy
FTSMSKLLRHKRKHDDDRRFTCPVEGCGKSFTRAEHLKGHSITHLGTKPFVCPVEGCCARFSARSSLYIHSKKHLQDVDTWKSRCPVSTCNKLFTSKHSM


Parental protein
KAHVVRQHSRRPDLFPQLGAPSSLTPSSELGGPGQSELNNIDLAALFSDTPGDGGSAVGASDEALNSGILTIDVTSVSSSLGGNLP-ANNSSLG-PMDPL
K.H....H....DL..QL.A..SLTPSSEL...GQS.L....L..LFSD.PG....AV.......NSGILTIDV.SVSS.L.GNLP.ANNSSLG...DP.
Retrocopy
KTHMAKRHNLGQDLLAQLEAANSLTPSSELASQGQSDLSDAELVSLFSDVPGSSSAAV-LDTALVNSGILTIDVASVSSTLAGNLPAANNSSLGQALDPR


Parental protein
VLVAHSDIPPGLDSPLVLGTAATVLEQSSFSVDDVQTVSAGALGCLVALPVKDVGQDPEAVTSSSNLAANTTTLTSSSVPQGSTGVPELQAPIKVEPASP
.L.A..D.P..LD..L..GT.A....QS....DDV...SAG.LG.L..L..K...Q.P.A.T.SS.L......LT.SS.......V..L..P.K.E....
Retrocopy
GLMATGDLPQSLDTSLFFGTTAAGFQQSPLGMDDVSSLSAGPLGSLGSLAMKNSSQEPQALTPSSKLTVDSDALTPSST-LCENSVSDLLTPTKAEWNIH


Parental protein
PGPGAFRQRERSR
P....F.Q.E...
Retrocopy
PDSDFFGQEEETQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide