RetrogeneDB ID:
retro_ecab_1067
Organism:
Horse ( Equus_caballus )
Location:
X:48844738-48845358 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
96.63 %
Coverage:
62.16 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
G3PDH
Parental gene aliases:
GAPDH, G3PDH
Parental gene description:
glyceraldehyde-3-phosphate dehydrogenase [Source:RefSeq peptide;Acc:NP_001157328]

Genomic region (view in browser)





>retro_ecab_1067
CCCCTGTTTGTGATGGGCGTGAACCATGAGAAGTATGACAATTCCCTGAAGATTGTCAGC
AATGCCTCCTGCACCACCAATTGCTTGGCCCCCCGGCCAAGGTCATCCATGACCACTTTG
GCATCGTGGAGGGACTCATGACCACAGTGCATGCCATCACTGCCACCCAGAGGACTGTGG
ATGGCCCCTCTGGGAAGCTGTGGCGCGATGGCCGAGGGGCTGCCCAGAACATCATCCCTG
CTTCTACTGGTGCTGCCAAGGCTGTGGGCAAGGTCATCCCTGAGCTGAACGGGAAGCTCA
CTGGCATGGCCTTCCATGTCCCCACCCCTAACATGTCAGTCGTGGATCTGACCTGCCGCC
TGGAGAAAGCTGCCAAATATGATGAGATCAAGAAGGTGGTGAAGCAGGCATCGGAGGGCC
CCCTCAAGGGCATCCTGGGCTACACTGAGGACCAGGTTGTCTCCTGCGATTTTAACAGTG
ACACCCACTCTTCCACCTTCGATGCTGGGGCTGGCATTGCCCTCAACGACCACTTTGTCA
AGCTCATTTCCTGGTATGACAATGAATTTGGCTACAGCAATAGGGTGGTGGACCTTATGG
CCCACATGGCCTCCAAGGAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.15
SRP021940_embryo 0.31
SRP021940_placental_villous 0.27
SRP021940_synovial_membrane 0.21
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PMFVMGVNHEKYDNSLKIVSNASCTTNCLAPL-AKVIHDHFGIVEGLMTTVHAITATQKTVDGPSGKMWRDGRGAAQNIIPASTGAAKAVGKVIPELNGK
P.FVMGVNHEKYDNSLKIVSNASCTTNCLAP..AKVIHDHFGIVEGLMTTVHAITATQ.TVDGPSGK.WRDGRGAAQNIIPASTGAAKAVGKVIPELNGK
Retrocopy
PLFVMGVNHEKYDNSLKIVSNASCTTNCLAPR/AKVIHDHFGIVEGLMTTVHAITATQRTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGK


Parental protein
LTGMAFRVPTPNVSVVDLTCRLEKAAKYDEIKKVVKQASEGPLKGILGYTEDQVVSCDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDL
LTGMAF.VPTPN.SVVDLTCRLEKAAKYDEIKKVVKQASEGPLKGILGYTEDQVVSCDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDL
Retrocopy
LTGMAFHVPTPNMSVVDLTCRLEKAAKYDEIKKVVKQASEGPLKGILGYTEDQVVSCDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDL


Parental protein
MAHMASKE
MAHMASKE
Retrocopy
MAHMASKE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide