RetrogeneDB ID:
retro_ecab_1078
Organism:
Horse ( Equus_caballus )
Location:
X:67740305-67740953 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.66 %
Coverage:
82.51 %
Frameshifts:
0
Stop codons:
8


Parental gene:
Parental gene symbol:
PSMA1
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) subunit, alpha type, 1 [Source:HGNC Symbol;Acc:9530]

Genomic region (view in browser)





>retro_ecab_1078
ATTGCATTGAAGAGAACACAGTAAACACTTGCGGCTCATCAGAAAAAAGTTCTCCACATT
GACTAACATCTTGGTGTCTCAGTTGTGGGGCTCACTGCTGATGCTAGACTGTTATATAAT
TTTATGCACCAGGACTACTTTGATTCCAGATTAGCAACTGACAGGCTACTTCTTGTGTCT
CATCTTATATCTCTAATTAGAAGCAAGACTCAGATACTAAGACAACAATATGGCCAGAGT
CCATATGGTGTTGGCCTACTTATTGCTGGTTATGATGTTATGGGCCCTCACATTTTCCAA
ACCTGCCCATCTGCTAACTAATTTGATTGCAGACCTATGTCCATTGGAGCCCATTCTTAA
TCAGCCTATACTAACTTAAAGAGATATATGTCTGAGTTTATGGAGTGAAATTTAAATGAA
CTGGTCAAACATAGCCTATGTGCCTTAAGAGAGACACTTCGTGCAGAGCAGGCCCTAACT
ACAAAGAAGGTTTCCATTGGAATTTTTGGTAAAGACTTCTAGTTTATGACCTATGATGAT
GATAATATGTCCAGCATTCATGGGCAGTCTTAAAGACCACAGAGAATGGCACAGCCTGTT
CAACTTGCTGATGAACCTGAAGAAAAGGCTAATTAATCAATAGAACAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQ
.ALKR.Q..LAAHQKK.LH.D.H.G.S..GLTADARLL.NFM.Q...DSR...DR.L.VS.L.SLI.SKTQI..Q.YG..PYGVGLLIAGYD.MGPHIFQ
Retrocopy
IALKRTQ*TLAAHQKKVLHID*HLGVSVVGLTADARLLYNFMHQDYFDSRLATDRLLLVSHLISLIRSKTQILRQQYGQSPYGVGLLIAGYDVMGPHIFQ


Parental protein
TCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLDELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKTQP
TCPSAN.FDCR.MSIGA.S.SA.T.L.R.MSEFME.NL.ELVKH.L.ALRETL.AEQ.LTTK.VSIGI.GKD..F..YDDD..S....G...RPQR..QP
Retrocopy
TCPSAN*FDCRPMSIGAHS*SAYTNLKRYMSEFME*NLNELVKHSLCALRETLRAEQALTTKKVSIGIFGKDF*FMTYDDDNMSS-IHGQS*RPQRMAQP


Parental protein
AQPADEPAEKADEPMEH
.Q.ADEP.EKA....EH
Retrocopy
VQLADEPEEKAN*SIEH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide