RetrogeneDB ID:
retro_ecab_1081
Organism:
Horse ( Equus_caballus )
Location:
X:72739564-72739902 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
80.0 %
Coverage:
50.44 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
U2AF1
Parental gene aliases:
No gene alias available
Parental gene description:
U2 small nuclear RNA auxiliary factor 1 [Source:HGNC Symbol;Acc:12453]

Genomic region (view in browser)





>retro_ecab_1081
TTGCACTGTATGGTGTGCTATGTTGAAATGCAGGAACACTATGATGAATTTTTTGAAGAG
GTTTTTATAGAAATGGAGAAGTATCGTTAAGTTGAGGAGATGAACGTCTGTGATAACCTT
GGAGATCACCTAGTTGGAGACGTGTATGTCAAGTTTCGCCATGAAGAAGATGCAGAAAAT
GTTGTAATTGACTTAAATAGCTGTTGGTTTAATGGACAGCGATCCGTGCTGAGCTCTCCC
CTGTGACCGACTTCAGAGATGCCTGCTGCTCACAGTATGAAATTGGAGTGTGTACACAAG
GAGGCTTCTGCAACTTCCTGCATTTGAAGCCCATTTCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQ-PIHAELSPVTDFREACCRQYEMGEC
L.C.V..VEMQEHYDEFFEEVF.EME.KY..VEEMNVCDNLGDHLVG.VYVKFR.EEDAE..VIDLN..WFNGQ..I.AELSPVTDFR.ACC.QYE.G.C
Retrocopy
LHCMVCYVEMQEHYDEFFEEVFIEME-KYR*VEEMNVCDNLGDHLVGDVYVKFRHEEDAENVVIDLNSCWFNGQ/AIRAELSPVTDFRDACCSQYEIGVC


Parental protein
TRGGFCNFMHLKPIS
T.GGFCNF.HLKPIS
Retrocopy
TQGGFCNFLHLKPIS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide