RetrogeneDB ID:
retro_ecab_1082
Organism:
Horse ( Equus_caballus )
Location:
X:75023094-75023661 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.5 %
Coverage:
70.22 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
HNRNPDL
Parental gene aliases:
No gene alias available
Parental gene description:
heterogeneous nuclear ribonucleoprotein D-like [Source:HGNC Symbol;Acc:5037]

Genomic region (view in browser)





>retro_ecab_1082
AAAATGTTCATCGGGGGCCTCTCCGGGAATGTCAGTAAGCAAGGCCTTCTTGACTACCTC
AGCCAGTTTGGCGAGGTCGTAGATTTCATTATTAAAATCCACCCAGGCACTGGCCTATCC
AGGGGGTTTGGATTTGTGCTTTTCAAAGATAGTGCCACTGTTGAAAAGGTGCTCCAAGTC
AAAGAGCACAAACTGGATGGCAAGACGATCCAGCTTAGAAGGGCTAAAGCCGTAGTATCG
AGATTCCCTCCCAAAAAGGTTTTTGTGGGAGGGCTGAACCCTCGTCTGTCTGAAGAAAAA
ATCAGACAGTACTTTGGGACGTTCGGAGTGATTCAGGATATCAAGCTTCCAGTGAATTCC
AAAACAAATGAAAGACGAGCTTTCTGTTTTATCACGTATGCTGATGAAAAGGCAGTGAGG
AAGCTGTTAGAAACCAGGTACCATCGAATTGGCTCCAGGCGGTGTGAAGTTAAAATCGCA
TTCCCAAAGGAATATAAGAGGCTGCGACAGCTGGGAGGAAGAGATGCTCCGTTTGCCAGG
CTGAGCAGCTCCCGGGATGGAAGAGGC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 1.6

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQ
KMFIGGLS...SK..L..YLS.FGEVVD..IK..P.TG.SRGFGFVLFKD.A.V.KVL..KEHKLDGK.I...RAKA.....PPKKVFVGGL.P..SEE.
Retrocopy
KMFIGGLSGNVSKQGLLDYLSQFGEVVDFIIKIHPGTGLSRGFGFVLFKDSATVEKVLQVKEHKLDGKTIQLRRAKAVVSRFPPKKVFVGGLNPRLSEEK


Parental protein
IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTR-GRG
I..YFG.FG.I..I.LP...KTNERR.FCFITY.DE..V.KLLE.RYH.IGS..CE.K.A.PKE..R..Q....GGR.A........R.GRG
Retrocopy
IRQYFGTFGVIQDIKLPVNSKTNERRAFCFITYADEKAVRKLLETRYHRIGSRRCEVKIAFPKEYKRLRQ---LGGRDAPFARLSSSRDGRG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide