RetrogeneDB ID:
retro_ecab_1085
Organism:
Horse ( Equus_caballus )
Location:
X:80712714-80713314 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
74.75 %
Coverage:
64.52 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
AMMECR1L
Parental gene aliases:
No gene alias available
Parental gene description:
AMMECR1-like [Source:HGNC Symbol;Acc:28658]

Genomic region (view in browser)





>retro_ecab_1085
ATGGGAAAAAGACATCGTGTTTCTCCACTCAAGCCCAAGTTGGCAGAATGCTGTTGTGGG
GTCAAGAAGCTTAAATTACCTGGAAATGGAACACACAGTCACAGGAACCAGTCCACAACT
GTCCCCGGCTCTAGTTCAGGACATTTTCAAAACCACAAGCACGTGGGTGGCAGCAGTGGT
CAGGAGAATGTGTTGGACTTAACTCTGGGATCCAGAAATTCTCCCTATTATACAAATGAA
TCCCTCATCAGGAGCACTGAGCCCTCTCCTCGGGCCCAATGGAACTACCAACAACACCAA
AAATTTGGTGGTGACTGCAGAGATGTGCTGCTACTGCTTTGACATCTTCTATTGTCACCT
TTATGGCTTCCCACAGTCACAACTTCCTAGATTCACCAGTGATCCCTATCTGCCTTTGGT
GACATGGAAGACAGGGTAAGACAAGAAGTTTTCTGGCTATACTAGGACCTTCTCAGCCAT
AAATCTTTATTCAGGACTCAGGGAATATATGTTAACCAGTGCACTTAAGGACAGTTGATC
TCCCCCTTGACCTGAGAGGAGCTGCCTAAACTTTTCTGCTCTATCTCCTTACTAACTTCG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGKRRCVPPLEPKLAAGCCGVKKPKLSGSGTHSHGNQSTTVPGSSSGPLQNHQHVDGSSGRENVSDLTLGPGNSP-ITRMNPASGALSPLPRPNGTANTA
MGKR..V.PL.PKLA..CCGVKK.KL.G.GTHSH.NQSTTVPGSSSG..QNH.HV.GSSG.ENV.DLTLG..NSP.I..MNP.SGALSPL..PNGT.N..
Retrocopy
MGKRHRVSPLKPKLAECCCGVKKLKLPGNGTHSHRNQSTTVPGSSSGHFQNHKHVGGSSGQENVLDLTLGSRNSP\IIQMNPSSGALSPLLGPNGTTNNT


Parental protein
KNLVVTAEMCCYCFDVLYCHLYGFPQPRLPRFTNDPYPLFVTWKTGRDKRLRGCIGTFSAMNLHSGLREYTLTSALKDSRFP-PLTREELPKLFCSVSLL
KNLVVTAEMCCYCFD..YCHLYGFPQ..LPRFT.DPY...VTWKTG.DK...G...TFSA.NL.SGLREY.LTSALKDS..P.PLT.EELPKLFCS.SLL
Retrocopy
KNLVVTAEMCCYCFDIFYCHLYGFPQSQLPRFTSDPYLPLVTWKTG*DKKFSGYTRTFSAINLYSGLREYMLTSALKDS*SP/PLT*EELPKLFCSISLL


Parental protein
TN
T.
Retrocopy
TS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide