RetrogeneDB ID:
retro_ecab_109
Organism:
Horse ( Equus_caballus )
Location:
28:27702539-27703559 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
56.58 %
Coverage:
96.88 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
NSMCE4A
Parental gene aliases:
No gene alias available
Parental gene description:
non-SMC element 4 homolog A (S. cerevisiae) [Source:HGNC Symbol;Acc:25935]

Genomic region (view in browser)





>retro_ecab_109
GAGGAAGAGAGAGAACCCATAAAGGTGGAAGTGGCGCTGGGGGCTGACGGCTGCTCTGAC
GACCTCGGCTGTGGCGATGCCGGCATCACTCCAGACCTCCTAGGGCTTGCGGCTGACGAG
GAGAAATGCCGGAATATCCGCAAGCAGTACTGGCAGCTCATCTACAACGTGCAGCAGAAC
CGTGATGACATAGTGAACACAGCCAGCGACTCATTAACCGAGGCTCTTGAGGAAGCCAAC
GTCCTGTTTGACGGAGTGAGCCGAACGAGAGAAGCAGCCCTCGATGCCCAGTTTCTTGTT
TTGGCTTCTGATTTGGGTAAAGAAAAAGCAAAGCAGCTAAACTCTAATACGAGCTTCTTT
AATCAAGTAGCGTTTTGTGACTTCCTCTTTCTGTTTGTGGGTCTAAACTGGATGGAAGAT
GATGAACAGGATGAGTTGAGTGGCTGTGATGACAACGTACCTCTTTCCTTCTGGGAGACG
GTACAGAAGGAGGCATCGTCCTGGATGTTGCGAGCTGAAACATTCCACTTTATTTTTGGT
TCGTTCAAGTCAGAGCCCTCTGCGCCAAAGCACCGGCTCGACCACCAGAAAAAAGTTCAC
AAGATGGAAGAAAACGGGGATATGCCTACAAAGCTGAGGAAGGTGGACCTGAATAGTAAT
CAAGAAGCGACAGAAAAAGAAGTAGAAAGAATCTTGGGATTGTTGCAAATGTACTTTCGA
AAGTATCCTGATACTCCCGTGTCCTATTTTGAGTTTGTGATTGATCCGAACTCTTTTTCT
CGTACTGTGGAGAATATATTTTATGTTTCTTTCATTATAAGGGATGGTTTTGCAAGAATA
AGGCTTGACCAAGACAGGCTGCCAATATTAGAGCCAATTAATATTAACCAAATGGGTGAG
GGAAATGATCCCAGTTCCCATGGCAGGAAACAGGGAGTTATATCTTTGAGTTTAGAGGAC
TGGAAAAATATTGTGGCAGCTTTTGAAATTTCAGAGGCTATGATCACAAACTCATACTGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 1.57
SRP021940_cerebellum 2.64
SRP021940_embryo 2.18
SRP021940_placental_villous 0.72
SRP021940_synovial_membrane 1.43
SRP021940_testis 157.95

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ENREDILN-ASDKLTEVLEEANTLFNGVSRAREAVLDAHFLVLASDLGKEKAKQLRSDLNSFDMLRYVETLLTHMGVNPLEAEELIRDEDSSDFEFIVYD
.NR.DI.N.ASD.LTE.LEEAN.LF.GVSR.REA.LDA.FLVLASDLGKEKAKQL.S....F........L....G.N..E..E...DE.S.........
Retrocopy
QNRDDIVNTASDSLTEALEEANVLFDGVSRTREAALDAQFLVLASDLGKEKAKQLNSNTSFFNQVAFCDFLFLFVGLNWMEDDE--QDELSGCDDNVPLS


Parental protein
SWKISGKTAENTFNKTHTFHFLLGSIQGEFPVPKPRTDRPRKVPMIEQRREMPAQLKRME-ESHQEATEKEVERILGLLQTYFREDPDTPMSFFDFVIDP
.W....K.A........TFHF..GS...E...PK.R.D...KV...E....MP..L......S.QEATEKEVERILGLLQ.YFR..PDTP.S.F.FVIDP
Retrocopy
FWETVQKEASSWMLRAETFHFIFGSFKSEPSAPKHRLDHQKKVHKMEENGDMPTKLRKVDLNSNQEATEKEVERILGLLQMYFRKYPDTPVSYFEFVIDP


Parental protein
HSFPRTVENIFHVSFIIRDGFARIRLDQDRLPIIEPVNINEESEGIDQNTQIRNQGIIALSYRDWEEIVKTFEISEPVIAS
.SF.RTVENIF.VSFIIRDGFARIRLDQDRLPI.EP.NIN...EG.D.....R.QG.I.LS..DW..IV..FEISE..I..
Retrocopy
NSFSRTVENIFYVSFIIRDGFARIRLDQDRLPILEPININQMGEGNDPSSHGRKQGVISLSLEDWKNIVAAFEISEAMITN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide