RetrogeneDB ID:
retro_ecab_1091
Organism:
Horse ( Equus_caballus )
Location:
X:111508787-111509369 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.13 %
Coverage:
94.06 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
C16orf72
Parental gene aliases:
No gene alias available
Parental gene description:
chromosome 16 open reading frame 72 [Source:HGNC Symbol;Acc:30103]

Genomic region (view in browser)





>retro_ecab_1091
ATGTGGGGACCCCTTCCCACGAAGTGCGGCATGGCCGTGACCAGCCTCTACAAAGAGAGC
GGGGATGCCCACCAGCGAAGTTTTGACCTGGGCGTCCAGGTGGGCTACCAGCGTCGCATC
AGAGACGTGCTGGAGTGGGTGAAGAAGGGCCGGAGCACCATTCTCCGTGAAGACCTGATT
AGCTTCCTGTGTGGCAAAGTGCCGCCCGTGCCGCCACCACGCTCCCCCAGGACGCCCTCG
AAGCCCCCCGCTGGGGCCACCAGCCAGGCCGCAGCCATCGAATCCAGCTCGTCGGTGGAG
GTCGACTTGCAGCCCTTCCATGAGGCCATCGCGCTGCATGGCCTCAGTGGCGCCATGGCC
AGCATCAGCGTGCGGTCGGGCACACCTGGCTCCCCACCTCAGGCCAGTGGCGGCGCCAGC
GGTGGGCGTCAAAAAAGTAATGGCCTTGAAGACGACTTGAAGCCCTTCGACCTGGAAGAA
CTGGCCCCCCATGCAGACAGTGGGGGGAACCGCAAGCGCACCTCGGCCCAGTGTGGGGAT
GGCATCTCAGACTCCCCAACCCACAAGCGCAACCGAATGGTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.23
SRP021940_cerebellum 1.74
SRP021940_embryo 2.35
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.13
SRP021940_testis 2.55

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LWVPIQN-AATAVTNLYKESVDTHQRSFDIGIQIGYQRRNKDVLAWVKKRRRTIRREDLISFLCGK---VPPPRNSRAPPRLTVVSPSRATSAETSSSVE
.W.P.......AVT.LYKES.D.HQRSFD.G.Q.GYQRR..DVL.WVKK.R.TI.REDLISFLCGK...VPPPR..R.P........S.A...E.SSSVE
Retrocopy
MWGPLPTKCGMAVTSLYKESGDAHQRSFDLGVQVGYQRRIRDVLEWVKKGRSTILREDLISFLCGKVPPVPPPRSPRTPSKPPAGATSQAAAIESSSSVE


Parental protein
TDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGSNASRRR-NGLHDVDLNTFISEEMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI
.DLQPF.EAIALHGLSGAMASISVRS.TPGSP...S.G....R...NGL.D.DL..F..EE.A.H.D.GG.RKRTSAQCGD.I.DSPTHKRNRM.
Retrocopy
VDLQPFHEAIALHGLSGAMASISVRSGTPGSPPQASGGASGGRQKSNGLED-DLKPFDLEELAPHADSGGNRKRTSAQCGDGISDSPTHKRNRMV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide