RetrogeneDB ID:
retro_ecab_1092
Organism:
Horse ( Equus_caballus )
Location:
X:116291333-116292647 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
53.54 %
Coverage:
78.47 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
ELL2
Parental gene aliases:
No gene alias available
Parental gene description:
elongation factor, RNA polymerase II, 2 [Source:HGNC Symbol;Acc:17064]

Genomic region (view in browser)





>retro_ecab_1092
ATCAAAATCCCCCCAAACAATTCACCAACTGATGTATCCAACTTTAACTTTCAATTGTCA
AATGTGAGTAAAGACAACCATCAAGACCATACTCAACAAACTGTCTCAGGCTATAGTCCC
TCACAGCTCAGTTGGCTGCACTTGAGGCGAGATAAAATGACGCAGTGTAGAACAACCAAT
GCTTCTCAGATAACACCAGTAAGAACCCAGGCAGAAGAGGAATCCTGCAACAAATGGAAA
AAAATTGGAAAGCCATGTGGAAAGAAAAGAATGCCAATTCGGAAAGCACCTCAAGCCATT
CCAGATCCAGTGCCTGAGAGAAAAAGAACAGCGCCCCTTAACCCTGCATACACAATTCGA
AAATCACGAGTTCCCAACAGTGTCCGCTTGCGGCCATATAGGGACAGGGTGATTCACTTA
CTGGCATTGAAGGACTACAAGAAAACAGAACTGCTTTTTCGACTTCGGAAAGATGGTGTG
GAACAAAATGACGAGAACTCCCTTGAAAATATCCTAAACCAAGTAGCCAATCTGAATACT
CAGGATTTTTCATATACCTTAAAGGATTATGTATTTAAAGAACTCCAAAGAGACTGGCCT
GGATACAGTGAACTGGACAAGCAGTCATTGGAGTTGGTGCTTTCCCAAAGAGTAGATCCA
TTTCAGAATGCTACTGACATTAATCACTCAGAATCTTCTATAGGTTCTAGTACAAATGAA
ACATCATCTCCTCAGAAATGGCTTTTCAATTCTGCTGTTATTGATCCTTTAAAGAAAAAG
AAAGTCAGAATATCTCACCTGACAACTACAGTACAGTCAACATCAAACGGTCGTTTGAAT
AACACCAGTGAAAAATCTGCTGTTGGTCTCCCACCACTCTCTGAAGCTCCTGCCAACCCC
ATCCCTCCACCATTGCCCACAGCCCGTCTTCCTGTTTCACATGCTCCTCGGCGTGTACGT
TCCAACCGCAGTTCTCGCAGCACTGCAGAAGGACCTGGAACCCCAGATCCAGATGGTGAC
AGTTTTAGTCAAAACAGTAGAATCTTCGAGAGCCAGCAGGGTAAACATACTTTGAAAATG
ATAGCCTCGATAACAATTCCAATTAAGTATTCGAAGCTCATGGGGAAAAATTATTTGATG
CCTGATAAGTTCAAATATGAAATTGTGAAATGCAAAGCAAAGAGCCAAGAGTACAGTATT
GAGATCACCGAGAAACAGAAAACAGATCCTGAAAGATGCGGTAAAGGTGCAAAGCTGAAT
TCCGGGGAAGAAGTTGAAAAGCTTTGCACTGCCTCTGGGAAGACTTGTTCAACA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 2.73

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IKIPKNDPPNEVHTFNFYLSNVGKDNPQGSFDCIQQTFSSSGASQLNCLGFIQDKITVCATNDSYQMTRERMTQAEEESRNRSTKVIKPGGPYVGKRVQI
IKIP.N..P..V..FNF.LSNV.KDN.Q...D..QQT.S....SQL..L....DK.T.C.T....Q.T..R.TQAEEES.N...K..KP.G....KR..I
Retrocopy
IKIPPNNSPTDVSNFNFQLSNVSKDNHQ---DHTQQTVSGYSPSQLSWLHLRRDKMTQCRTTNASQITPVR-TQAEEESCNKWKKIGKPCGK---KRMPI


Parental protein
RKAPQAVSDAVPERKRSTPMNPANTIRKTHGSSSVSQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNPKDLSYTLKDYVFK
RKAPQA..D.VPERKR..P.NPA.TIRK.....SV..RPYRDRVIHLLALK.YKK.ELL.RL.KDGV.Q.D.NSL..IL.QVANLN..D.SYTLKDYVFK
Retrocopy
RKAPQAIPDPVPERKRTAPLNPAYTIRKSRVPNSVRLRPYRDRVIHLLALKDYKKTELLFRLRKDGVEQNDENSLENILNQVANLNTQDFSYTLKDYVFK


Parental protein
ELQRDWPGYNEIDRRSLESVLSRKLNPSQNAASTSRSESPVCSSRDTASSPQKRLLDSDFIDPLMNKKARISHLTNRVPPTLNGHLNPTSEKSATGLPPP
ELQRDWPGY.E.D..SLE.VLS....P.QNA.....SES...SS....SSPQK.L..S..IDPL..KK.RISHLT..V..T.NG.LN.TSEKSA.GLPP.
Retrocopy
ELQRDWPGYSELDKQSLELVLSQRVDPFQNATDINHSESSIGSSTNETSSPQKWLFNSAVIDPLKKKKVRISHLTTTVQSTSNGRLNNTSEKSAVGLPPL


Parental protein
PAAAAISTPPPPPSAHLPVSNPPQTVNSNSNSPSTPEGRGTQDLPVDSFSQNGSVYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHSMSHKKSKKKS
..A.A...PPP.P.A.LPVS..P..V.SN..S.ST.EG.GT.D...DSFSQN....E.QQ.K.T....L..........K..K.M..N..M...K.K...
Retrocopy
SEAPANPIPPPLPTARLPVSHAPRRVRSNRSSRSTAEGPGTPDPDGDSFSQNSRIFESQQGKHT----LKMIASITIPIKYSKLMGKNYLMP-DKFKYEI


Parental protein
KKHREKDQIKKHDIEMIEEKEEDLKREEEIAKLNDSSPDSNEGVKEGCTAST
.K...K.Q.....IE..E....D..R....AKLN............G.T.ST
Retrocopy
VKCKAKSQ--EYSIEITEKQKTDPERCGKGAKLNSGEEVEKLCTASGKTCST


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide